KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_90799Help
Entry
DICPUDRAFT_90799  CDS       T02090                                 

Definition
hypothetical protein
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Brite
Enzymes [BR:dpp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     DICPUDRAFT_90799
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 281 aa AA seqDB search
MKRFIEDNKTSLIVSLGVITVSSLAYLSYKQEFFKRRINPLPQTQNELVDLLHYQKRMVL
NRDIVKTLRYVDRKLFLDEDCKNPYYDEPKPIGYNATISAPHMHAVMLDYLAAYIPKNNG
LALDIGSGSGFVSACLADLMGATGKVVGVEHIPELVDRAKNSINKLDSELLNRIEFKVGD
GIQGYDNGTKYDVIYLGAAIESLGVAATLIDQLKQGGRMIMPVGKSEDFHELMIVDKDID
GMVSVKSCGVVRFVPLVKNKEEQLSIYKSPNQTKSPDYSCS
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagatttatagaagataataaaactagtttaattgtatcactaggtgtaataaca
gtttcatctttagcttatttatcatataaacaagagtttttcaaaagaagaattaatcca
ttgccacaaacacaaaatgaattagtagatttacttcattatcaaaaaagaatggtatta
aatagagatattgttaaaacattaagatatgtcgatagaaaattgtttttggatgaggat
tgtaaaaatccatattatgatgagcccaaaccaataggttataatgctacaatttcagca
ccacatatgcatgctgtaatgttggattatttagctgcttatataccaaagaataatggt
ttggcgctagatatcggtagcggttcagggtttgttagtgcatgtttggcagatttaatg
ggtgcaacaggtaaagtggttggtgttgaacatatcccagaattggttgatagagctaag
aatagtattaataaattagatagtgagctattaaatagaatcgagtttaaagtgggcgat
ggtatccaaggttatgataatggcacaaagtatgatgttatttatttgggtgccgccatc
gaatcattaggggttgcagctacattaatagaccaattaaaacaaggtggtagaatgatc
atgccagtaggtaagtctgaagatttccatgaattaatgattgtagataaagatatagat
ggcatggttagtgtaaaatcatgtggagttgttagatttgtaccattggttaaaaataaa
gaggagcagttatcaatttataaatcaccaaatcaaactaaaagcccagattattcctgc
tcctga

DBGET integrated database retrieval system