KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_91322Help
Entry
DICPUDRAFT_91322  CDS       T02090                                 

Definition
hypothetical protein
Orthology
K04437  
filamin
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Brite
Exosome [BR:dpp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   DICPUDRAFT_91322
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 860 aa AA seqDB search
MATDGSTGKTWIDVQKKTFTGWANNYLKERILKIGDLGTDLEDGVLLINLLEIISSKKIL
KYNKTPKIRMQKIENNNMAVNFIKSEGLKLVGIGAEDIVDCQLKLILGLIWTLILRYQIQ
MSESDNSPKAALLEWVRKQVAPYKVVVNNFTDSWCDGRVLCALTDSLKPGVREMNTLTGD
AVQDIDRSMDISLEEYEIPKIMDAVDMNSLPDELSVITYVSYFRDYALNKEKRDADALAA
LEKKRRETSDASQVEAYGPGLEGGFVNKKADFTIKAINYYGEPLANGGEGFTVKVKDAEG
NEYPVSLVDNNNGTYDGSYTVAVPQDYTVVIQLDDVDIKNSPFNVKIDGSDPKESNAYGP
GLEGGKVGQPAQFKIQGRNKEGESLTQGGDDFTVKVNGPNGPVDATVKDNGDGSYDVEYN
PTTGGDHNVEVFLRGEPLAQGPADVKILNSDANNSYCEGPGFEKAQAKRPTEFTIHSVGV
DNKPCTAGGDPFQVAISGGSPIQIAIQDNDDGTYTVSYTPEQPGDYEIQVTLNDEPIKDI
PKSIHIKPAADPEKSYAEGPGLEGGECFQPSQFKIHAVDPDGVHRTDGGDGFVVTIEGPA
PVDPVMVDNGDGTYDVEFEPKEPGEYTINLTLDGDNVNGFPKTVIVKPAPSHEHSYAKGK
GLKKAYDNEVAEFKIYAVDTTGKPRTDGGDPFECNITGPSGDVPAKITDNNDGTYNVEYE
PLVAGPHEINVSIRGNNIKDMPKNVECLEGADSGSSFGSFTFTVASKNKKGEPKTVGGDR
FLVAITGPAEEIQLNAIDNQDGTYTAAYSLVGNGRFNIAVKLNDRHIEGSPFKANIGEVK
KNPDVPSFTTTAKANYDEEN
NT seq 2583 nt NT seq  +upstreamnt  +downstreamnt
atggccacagacggttcaacaggaaaaacatggattgatgtccaaaaaaaaaccttcact
ggttgggcaaacaattatttaaaagaaagaattttaaagattggtgatcttggtacagat
ttagaagatggtgttcttttaattaatcttttagaaattatctcaagcaagaagatcctc
aaatataacaaaaccccaaagatcagaatgcaaaagattgaaaacaacaacatggctgtt
aactttattaaaagtgaaggcttaaaattagttggtattggtgctgaagatattgtcgat
tgccaattaaaattaattctcggtttaatctggactttaattttaagatatcaaattcaa
atgtcagaaagcgataactcaccaaaagctgctcttttagaatgggttagaaaacaagtt
gctccatacaaagttgtcgttaataactttaccgactcatggtgcgatggtcgtgttctc
tgtgctctcactgattcattaaaaccaggtgtcagagaaatgaacactctcaccggtgat
gccgtccaagatatcgatcgttctatggatatctctcttgaagaatatgaaattccaaag
attatggatgctgtcgatatgaattcacttccagatgaactttcagttattacctacgtt
tcatatttccgtgattacgccctcaacaaagaaaaaagagatgctgatgctcttgctgct
cttgaaaagaagagacgtgaaaccagcgatgcctcacaagttgaagcttatggtccaggt
ttagaaggtggtttcgttaacaagaaagctgatttcaccattaaagccatcaactactat
ggtgaaccattagccaacggtggtgaaggtttcactgtcaaagttaaagatgccgaaggt
aacgaatatccagtttcattagttgataataacaatggtacttatgatggttcatacacc
gttgctgttccacaagactacactgtcgtcattcaattagatgatgttgatatcaaaaac
tcaccattcaacgtcaagattgacggttcagatccaaaagaatcaaatgcttatggtcca
ggtttagaaggtggtaaagttggtcaaccagctcaattcaagattcaaggtcgtaacaaa
gaaggtgaatcactcactcaaggtggtgatgatttcactgttaaagttaatggtccaaat
ggtccagttgatgccaccgtcaaagataatggtgatggctcatacgatgttgaatacaac
ccaactactggtggtgaccacaacgtcgaagttttccttcgtggtgaaccattagctcaa
ggtccagctgatgttaaaatcttaaactctgatgccaacaactcatactgtgaaggtcca
ggtttcgaaaaagctcaagctaaacgtccaactgaattcaccattcacagtgttggtgtt
gataacaaaccatgcactgcaggtggcgatccattccaagttgccatcagtggtggttca
ccaattcaaattgccatccaagataacgatgatggtacttacactgttagctatacccca
gaacaaccaggtgactatgaaattcaagttactctcaatgatgaaccaatcaaagatatt
ccaaaatcaattcacattaaaccagctgccgacccagaaaaatcatacgctgaaggtcca
ggtttagaaggtggtgaatgcttccaaccatcacaattcaagattcacgccgtcgatcca
gatggtgtccacagaactgatggtggtgatggttttgtcgttaccatcgaaggtccagct
ccagttgatccagttatggtcgacaatggtgatggtacatacgatgttgaattcgaacca
aaagaaccaggagaatacacaatcaatcttactttagatggtgataatgtcaatggtttc
ccaaagactgttatcgtcaaaccagctccatcacacgaacactcatacgccaaaggtaaa
ggtttaaagaaagcttatgacaatgaagtcgctgaattcaagatttacgccgttgatacc
accggtaaaccaagaactgatggtggtgatccatttgaatgtaacattactggtccatca
ggcgatgtcccagctaaaatcactgataacaatgatggtacttacaacgttgaatacgaa
ccattagttgccggtccacacgaaattaatgtttcaatcagaggtaacaatattaaagat
atgccaaagaatgtcgaatgtcttgaaggtgctgactctggctcatcattcggtagtttc
actttcaccgttgcttccaaaaacaagaaaggtgaaccaaaaactgttggtggtgataga
tttttagttgccattactggtccagccgaagaaatccaattaaatgctattgataaccaa
gacggtacctacactgctgcttattcattagttggtaacggtcgtttcaatattgctgtc
aaattaaacgatagacacatcgaaggttcaccattcaaagccaatattggtgaagtcaag
aagaatccagatgttccatcattcaccactaccgccaaagctaactatgatgaagaaaac
taa

DBGET integrated database retrieval system