KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_91353Help
Entry
DICPUDRAFT_91353  CDS       T02090                                 

Definition
(RefSeq) hypothetical protein
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
dpp00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:dpp00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    DICPUDRAFT_91353
Enzymes [BR:dpp01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     DICPUDRAFT_91353
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_6 NAD_binding_1 NAD_binding_6
Motif
Other DBs
NCBI-GeneID: 10506421
NCBI-ProteinID: XP_003284619
JGI: Dicpu1_91353
UniProt: F0ZB34
Position
Unknown
AA seq 279 aa AA seqDB search
MQTFEFILAVGTIVLAGVVYVFMSSSNKGDEKKSNETGSVALDPNEYKKFQLKEKFIVNH
NTRIFRFALPNENDILGLPIGQHISLRAVVGGKEVYRPYTPISSDEERGYFDLLIKVYEK
GAMSGYVDNMFIGDSIEVKGPKGKFNYTANMRKHIGMLAGGTGITPMLQVIKAILKNPED
KTQISLVFGNITEEDILLKKELDELAEKHSNFNVYYVLNNPPKGWNQGVGFVSQEVIQSK
LPAPSDDTMVVMCGPPMMNKAMTGHLTSLGYQENSIFTF
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacttttgaatttattttagcagttggaactatagttttggcaggtgttgtatat
gttttcatgtcatcaagtaataaaggtgacgaaaagaaatcaaacgaaacaggttcagtc
gcacttgatccaaacgaatataaaaaattccaattaaaagaaaaattcattgttaatcat
aatactagaatttttagattcgctttaccaaacgaaaatgatattttaggtctcccaatt
ggtcaacacatttcattaagagcagtcgttggtggtaaagaagtctaccgtccatacaca
ccaatttcatcagatgaagaaagaggttactttgatcttttaattaaagtttatgaaaag
ggtgccatgtcaggttacgtcgataatatgtttattggtgattccatcgaagttaaaggt
ccaaaaggtaaattcaactacactgccaacatgcgtaaacatatcggtatgttagctggt
ggtacaggtattactccaatgttacaagtcatcaaagccatccttaagaacccagaagac
aaaactcaaatctctttagtctttggtaatatcaccgaagaagatatcctcctcaagaaa
gaattagatgaattagctgaaaaacactcaaatttcaatgtttactatgttctcaataat
ccaccaaagggttggaaccaaggtgttggttttgtttcccaagaagttattcaatctaaa
ttaccagctccatcagacgatactatggttgtaatgtgcggtccaccaatgatgaataaa
gccatgactggtcatttaacatcattaggttatcaagaaaatagcattttcactttttaa

DBGET integrated database retrieval system