KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_91884Help
Entry
DICPUDRAFT_91884  CDS       T02090                                 

Definition
hypothetical protein
Orthology
K05759  
profilin
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Brite
Exosome [BR:dpp04147]
 Exosomal proteins
  Proteins found in most exosomes
   DICPUDRAFT_91884
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 127 aa AA seqDB search
MSWQGYVDEQLVGTGNITAAVIIGAADGSTWATSKNWTLKGGEGAGIVALYKNPADSFAK
GITAGGVKYMAIKADDRSIYGKKGATGIVVVKTTQCIIIGYYDETKQPGNAAVVCEKLGD
YLIENGY
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgagctggcagggttatgttgatgaacaattagttggaactggaaatattacagctgca
gttatcattggcgcagccgacggtagtacatgggccacatctaaaaactggactttaaaa
ggtggtgaaggagctggtattgttgctttatataaaaacccagctgattcattcgcaaaa
ggaattactgctggcggagtaaagtacatggctattaaagctgatgatcgttcaatctac
ggtaaaaaaggtgccaccggtattgtagtggttaagaccacccaatgtattatcattggt
tactatgatgaaacaaaacaaccagggaatgctgctgttgtttgtgaaaaacttggtgac
tatcttattgaaaatggatactaa

DBGET integrated database retrieval system