KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_91968Help
Entry
DICPUDRAFT_91968  CDS       T02090                                 

Definition
hypothetical protein
Orthology
K18669  
dual specificity tyrosine-phosphorylation-regulated kinase 2/3/4 [EC:2.7.12.1]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Brite
Enzymes [BR:dpp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     DICPUDRAFT_91968
Protein kinases [BR:dpp01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   DICPUDRAFT_91968
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 379 aa AA seqDB search
MTPAVALKLYINELTAAEQAEILDYPQIFFTGNTTKKIQPNPKLPNNGFDTETGEYKIVE
HDHIAYRFEVVSILGQGSFCQVVKAYDYKIGDFVALKILRNQKRFHQQALTEIKILEYLK
NNDPNSTANIVHLNNHFYFRNHLCLTFELLSMSLYDFLKINHFQGYNLSLVWRFGAQILT
SLKFLSKRDIIHADLKPENILLKQAGKSGIKIIDFGSSCFENEQIFPYIQSRFYRSPEVI
LGTKYDKSIDIWSLGCILVEIFTGSPLFPGADEPEQLACIMEVLGAPPKQVIDNSTRRDI
FFEDDYTPKQVKNSTTGEIYGVGTKPLKDLIRSGDDDFDNFILDCLKWIPSERISAEQGL
KHDWIVKLAPPSLSSTPSS
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgacaccagcagttgcattaaaattgtatataaatgaattaacagccgcagagcaagcc
gaaattttagattatccacaaattttctttacaggtaatactactaaaaagatccaacca
aatccgaaattaccaaacaatggttttgataccgaaactggtgaatacaaaattgttgaa
catgaccatatcgcatatagatttgaagttgtttcaattttaggtcagggttcattttgc
caagtagtcaaagcctatgattataaaattggtgactttgtagctttaaaaattttacgt
aaccaaaagagattccatcaacaagctttaacagaaattaaaattttagaatatttaaag
aacaatgatccaaattcaacagcaaatatagtgcatttaaataatcatttttattttaga
aaccatttatgcttaacatttgaactactcagtatgagtctttatgactttttaaagatc
aatcattttcaaggttacaatttaagtttagtttggaggtttggtgctcaaattttaact
tcacttaaatttttatcaaaaagagatataatacacgcagatttaaaacccgaaaatatt
ttattaaaacaagcaggcaaatctggtattaaaattattgattttggtagtagttgtttc
gaaaatgaacaaattttcccatacatccaatcaagattttatagatcacccgaagttata
ttaggaaccaaatatgataaatccatcgatatttggagtttaggttgtatattagttgaa
attttcacaggatcaccattattccctggtgctgacgaaccagaacaacttgcatgtatt
atggaggtgcttggagcaccccctaagcaagttatagataattccactcgtagagatatc
tttttcgaagatgactacacaccaaaacaagttaaaaatagtactacaggcgaaatctat
ggcgttggcaccaaaccacttaaagatctaattagatctggcgatgacgattttgataac
tttattttagattgtttaaaatggataccatctgaaagaattagtgcagaacaaggtcta
aaacatgactggatcgtaaaactagccccaccatcattatcctcaactccatcctcttaa

DBGET integrated database retrieval system