KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_92296Help
Entry
DICPUDRAFT_92296  CDS       T02090                                 

Definition
hypothetical protein
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:dpp00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    DICPUDRAFT_92296
Enzymes [BR:dpp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     DICPUDRAFT_92296
Protein phosphatases and associated proteins [BR:dpp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     DICPUDRAFT_92296
Transcription machinery [BR:dpp03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     DICPUDRAFT_92296
Spliceosome [BR:dpp03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    DICPUDRAFT_92296
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 321 aa AA seqDB search
MEIDLDSIISRLLEPRTTKPGKFVDLAEEEIRYLTVQATEIFINQPILLELEAPIKICGD
IHGQYYDLLRLFEYGGFPPQSNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFILRGN
HECASINRIYGFYDECKRRYNSKLWKAFTDCFNCLPVAAIIDEKIFCMHGGLSPDLKNMD
QIRRIARPTVVPDYGLLCDLLWADPDRNITGWEENDRGVSYTFGADIVEQFLKKHDLDLV
CRAHQVVEDGYEFFAKRQLVTLFSAPNYFGEFDNAGAMMGVDETLMCSFQILKPADKKKI
TNDSNGRPLTPLKNKQQKQKK
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggaaattgatttagattcaattatatctagacttttagaaccaagaactactaaacca
ggtaaatttgtcgaccttgcagaggaagaaattagatatttaacagttcaagcaacagaa
atttttataaatcaaccaattttattagaattagaagcaccaattaaaatttgtggagat
attcatggtcaatactatgatttacttcgtctctttgaatatggtggattcccaccacaa
tccaactacctctttttaggtgattatgtcgatcgtggtaaacaaagtttagagactatt
tgtcttttattagcctacaaaatcaaatatccagaaaactttttcattcttagaggtaat
cacgaatgtgcttcaatcaatcgtatttatggtttttatgacgaatgtaaaagaagatac
aactccaagctttggaaagcttttacagattgttttaattgtcttccagttgcagctatt
atcgacgaaaaaatcttttgtatgcatggtggtctttcaccagatctcaaaaacatggat
caaatccgtagaattgccagaccaacagttgtaccagattacggtcttttatgtgacctc
ttatgggccgatccagacagaaatattacaggttgggaagaaaatgatcgtggtgtatct
tatactttcggtgccgatattgtcgaacagttcctcaagaaacacgatctagatttggtt
tgcagagcccatcaagttgttgaagatggttatgaattctttgccaagcgtcaattggtc
acacttttctctgctccaaattactttggagagtttgataatgctggtgctatgatgggt
gtcgatgaaactttaatgtgctcattccaaattttaaaacctgccgataaaaaaaaaata
acaaatgatagtaatggtagaccattgactccactaaaaaacaaacaacaaaaacaaaaa
aaataa

DBGET integrated database retrieval system