KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_92296Help
Entry
DICPUDRAFT_92296  CDS       T02090                                 

Definition
hypothetical protein
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:dpp03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 321 aa AA seqDB search
MEIDLDSIISRLLEPRTTKPGKFVDLAEEEIRYLTVQATEIFINQPILLELEAPIKICGD
IHGQYYDLLRLFEYGGFPPQSNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFILRGN
HECASINRIYGFYDECKRRYNSKLWKAFTDCFNCLPVAAIIDEKIFCMHGGLSPDLKNMD
QIRRIARPTVVPDYGLLCDLLWADPDRNITGWEENDRGVSYTFGADIVEQFLKKHDLDLV
CRAHQVVEDGYEFFAKRQLVTLFSAPNYFGEFDNAGAMMGVDETLMCSFQILKPADKKKI
TNDSNGRPLTPLKNKQQKQKK
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggaaattgatttagattcaattatatctagacttttagaaccaagaactactaaacca
ggtaaatttgtcgaccttgcagaggaagaaattagatatttaacagttcaagcaacagaa
atttttataaatcaaccaattttattagaattagaagcaccaattaaaatttgtggagat
attcatggtcaatactatgatttacttcgtctctttgaatatggtggattcccaccacaa
tccaactacctctttttaggtgattatgtcgatcgtggtaaacaaagtttagagactatt
tgtcttttattagcctacaaaatcaaatatccagaaaactttttcattcttagaggtaat
cacgaatgtgcttcaatcaatcgtatttatggtttttatgacgaatgtaaaagaagatac
aactccaagctttggaaagcttttacagattgttttaattgtcttccagttgcagctatt
atcgacgaaaaaatcttttgtatgcatggtggtctttcaccagatctcaaaaacatggat
caaatccgtagaattgccagaccaacagttgtaccagattacggtcttttatgtgacctc
ttatgggccgatccagacagaaatattacaggttgggaagaaaatgatcgtggtgtatct
tatactttcggtgccgatattgtcgaacagttcctcaagaaacacgatctagatttggtt
tgcagagcccatcaagttgttgaagatggttatgaattctttgccaagcgtcaattggtc
acacttttctctgctccaaattactttggagagtttgataatgctggtgctatgatgggt
gtcgatgaaactttaatgtgctcattccaaattttaaaacctgccgataaaaaaaaaata
acaaatgatagtaatggtagaccattgactccactaaaaaacaaacaacaaaaacaaaaa
aaataa

DBGET integrated database retrieval system