KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_92549Help
Entry
DICPUDRAFT_92549  CDS       T02090                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:dpp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DICPUDRAFT_92549
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    DICPUDRAFT_92549
Enzymes [BR:dpp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     DICPUDRAFT_92549
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 469 aa AA seqDB search
MNSNGDFNDVKYKFNVKEYIEQEAKLLQQDWDTNPRWKGIKRDYTAEDVIRLRGSFKEEH
SIAKKGAEKLWELINDQSSYVPALGALSGNQAVQMVRGGLKAIYLSGWQVAADNNTSGQM
YPDQSLYAVNSVPELVRRINNALRRRDQIEFSEGNLEHQYLPTPIVADAEAGFGGPLNAY
ELMKSMIEAGASGVHWEDQLASEKKCGHMGGKVLVPTCQHIKNLTAARLAADVMGVSSII
VARTDSLGASLLTSDVDPRDKKFVTGKRTVEGFYNVNNGIDQAIERALSYAPYADLLWME
TSTPSVELAQQFADAVHAKFPGKLLAYNCSPSFHWKQHLKPDEIASFQQKLSDMGYKFQF
ITLAGFHALNLSMFELARDYKKTAMTAYVNLQDREFSLEGEGYTATRHQREVGTGYFDKV
SQIISGGQSSTLALVGSTEEEQFDEHIEKKKKLTNNDNGSKAKAKNAQV
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaattcaaatggtgattttaatgatgtaaaatataaatttaatgttaaggaatatatc
gagcaagaggccaaattattacaacaagattgggacactaatccaagatggaagggtatc
aagagagactacactgcagaagatgttatccgtcttagaggttcattcaaagaagaacac
tcaatcgcaaagaaaggtgctgaaaaactttgggaattaattaatgatcaaagtagttat
gttccagctcttggtgccttaagtggtaaccaagcagttcaaatggttcgtggtggtttg
aaagctatctatttaagtggttggcaagtagctgccgataacaatacaagtggtcaaatg
tatccagatcaatcattatatgctgtcaattcagtaccagaattagttcgtagaattaat
aatgcattaagaagacgtgaccaaatcgaattctctgaaggtaatcttgaacaccaatat
cttccaaccccaattgttgctgatgctgaagctggttttggtggtccattaaatgcctat
gaacttatgaaatcaatgattgaagctggtgcatctggtgtccattgggaagatcaatta
gctagtgaaaagaaatgtggtcatatgggtggtaaagttttagttccaacttgtcaacat
atcaaaaatcttactgctgctcgtttagctgctgatgttatgggtgtatcttcaattatt
gttgctcgtaccgattcattaggtgcctcattattaacaagtgatgttgatccacgtgat
aagaaatttgttaccggtaaacgtaccgttgaaggtttttacaacgttaacaatggtatt
gaccaagccattgaaagagctttaagctatgcaccatatgctgacttactttggatggaa
acttcaaccccatcggttgaattagcacaacaatttgctgatgctgttcatgctaaattc
ccaggaaaacttttagcttacaattgctcaccatcattccattggaaacaacacctcaaa
ccagatgaaattgcctcattccaacaaaaactttcagatatgggttataaattccaattc
atcaccttggccggtttccatgccctcaatctctccatgtttgaactcgctagagactac
aagaagactgccatgactgcttacgtcaatttacaagatagagaattctctctcgaaggt
gaaggttacactgcaacaagacatcaacgtgaagtaggtacaggttactttgataaagtc
tctcaaatcatctctggtggtcaatcaagcactcttgctttggtaggttcgaccgaagaa
gaacaatttgatgaacacattgaaaagaaaaagaaattaaccaacaatgacaatggttca
aaagccaaagccaagaatgcccaagtttaa

DBGET integrated database retrieval system