KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_93783Help
Entry
DICPUDRAFT_93783  CDS       T02090                                 

Definition
extracellular response kinase
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 367 aa AA seqDB search
MSSNEDIDKHVLRKYEVQQKLGKGAYGIVWKAVCKKTKQIVALKKIFDAFQNATDAQRTF
REIMFLQELHGHENIIKLLNVIKADNDRDIYLVFEYMETDLHAVIRANILEDIHKQFTIY
QLLKALKYMHSANVLHRDIKPSNLLLNSECLVKVGDFGLARSITQLESVNEANPVLTEYV
ATRWYRAPEILLGSTRYTKGVDMWSIGCILGELLGGKSMFPGNSTMNQLDLIIEVTGCPS
AEDIEAIKSPFAGTMLESLPPSNPRSLTDMYPHASQEALDLLRKLLQFNPDKRITAEEAL
SHPYVAQFHSPTDEPKCDRIIKIPIDDSQKLPITEYRNKLYNDIIKKKKEERKKQLATNP
TKPDTVS
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcaaatgaagatatcgataaacatgttttaagaaaatatgaagtacaacaaaaa
ttaggaaagggtgcttatggtattgtttggaaagcagtttgtaaaaaaacaaagcaaatt
gttgccctcaaaaagatttttgatgctttccaaaatgctaccgatgcccaaagaacattt
agagaaattatgtttttacaagaattacatggtcacgaaaatattattaaacttttaaat
gttattaaagcagataatgatagagatatttatttagtttttgaatatatggaaaccgat
ttacatgctgttatcagagcaaatattttggaagatattcataaacaatttacaatttat
caattattaaaagcattaaaatatatgcattcagcaaatgttttacatcgtgatattaaa
ccaagtaatttattacttaattcagaatgtttagttaaagttggtgattttggtcttgct
agatctattacacaattagaatcagttaatgaagctaatccagtattaactgaatatgtt
gccacccgttggtacagagcaccagagattttattaggctcaactcgttatactaaaggt
gttgatatgtggtctattggttgtattttaggcgagttattaggtggtaaatcaatgttc
ccaggtaattcaacaatgaatcaattagatttaatcattgaggttactggttgtccatcg
gctgaagatattgaagctattaaatctccatttgctggtactatgcttgaatctttacca
ccttcaaatccacgttcacttactgatatgtatccacacgcttcacaagaggctttagat
ttattaagaaaacttttacaattcaatccagataaaagaattacagctgaagaggcttta
agtcatccatatgtagcacaattccacagtccaaccgacgaaccaaaatgtgatcgtatc
attaaaatcccaattgatgatagtcaaaaattaccaattacagaatatagaaataaactt
tataatgatatcattaaaaagaagaaagaggaaagaaagaaacaattagcaacaaatcca
acaaaaccagatacagtttcataa

DBGET integrated database retrieval system