KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_93851Help
Entry
DICPUDRAFT_93851  CDS       T02090                                 

Definition
hypothetical protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:dpp00520]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:dpp00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:dpp00603]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:dpp00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 599 aa AA seqDB search
MKKSIILLCTIILSFIISKSVSIRFNNININRDNNDGVIDYTDNNINNFKSINSENSNDF
SPNIVAIWPKPKTVNHGNQTFQISSKFYFSSNLISSELLNNTAKRYYKMIFKEDNKNIPS
DKEVNYFNYLKIEVYSDDETLKIGFNESYTLHIKETYGILKAGTVYGAMRGLETFYQMVF
YNYSSQGYFIPEAPWNIYDEPRFPHRGVMLDTSRHWYSTTFLKKFIDSLSYNKFNTFHWH
AVDSQSFPLTSTTFPNMTRGAWTPLEIYSTKDIKEIVQHAKERGIRVVLEVDMPGHAKSW
GEAFSEVIPDGIEKAPGCNWDCSTYCDVPLDPSKQKSYDVAFSLLDEFTGTENSIFQDDY
CDVPIDPTNPLSIKVATALLEEYTQVFNDSFFHVGGDEINYDCWKGSGLIQQWMENEKYT
SFDNLTMYFEEQVFNKLIDLGKTPIVWEETFDVFGTKLSKDVIVQVYHSPTLAKSTTGNG
YKTLLSPADFYYLELEYSSWQRAYSFEPTSVISQDNIDLLLGGEGALWTDTIGVSQIISK
IYPSASSIAEKLWSPININNTDIAEYRLESFHCSLIFRGINSNNVLSTSIKNLKSCSKS
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatcaattattttattatgtacaataattttatcatttataatttcaaaatca
gtatcaatacgttttaataacataaatataaatagagataataatgatggtgttatagat
tatacagataataatataaataatttcaaaagtattaatagtgaaaatagtaatgatttc
agtccaaatattgttgcaatttggcccaaaccaaagactgtaaatcatggaaatcaaaca
tttcaaatatcttcaaagttttatttctcaagcaatttaatttcctcagaattattaaat
aatacagcaaaaagatattataaaatgatttttaaagaggataataaaaatattccatca
gataaagaggtaaattactttaattatttaaaaatagaagtttattcagatgatgaaact
ttaaagattggtttcaatgaaagttacactttgcatatcaaagaaacctatggtatatta
aaagcaggaactgtatacggcgctatgagagggttggaaactttttatcaaatggtattt
tataactattcatcacaaggttattttatcccagaagcaccatggaacatttatgatgag
cccagattcccacatagaggtgttatgttagatacaagccgtcattggtactctacaaca
tttttgaagaagtttatagattcgttatcatataataaattcaatactttccattggcat
gccgtcgattcacagtctttcccactaacaagtaccaccttccctaatatgaccaggggt
gcatggaccccactcgaaatttattcaacaaaagatattaaagaaattgttcaacatgca
aaagaaagaggtattcgtgtcgttttagaagttgacatgccaggacatgctaaaagttgg
ggtgaagctttttcagaagtaattccagatggaattgaaaaggcaccaggatgtaactgg
gattgttcaacatattgtgatgtaccactagatccttcaaaacaaaagtcatatgacgtt
gcattttcattgttagacgaattcacaggaaccgagaatagtatttttcaagacgattac
tgtgatgtccccattgaccctacaaacccactttcaataaaagtagcaactgctttgcta
gaagaatacacacaggttttcaacgattcattttttcatgtaggtggggacgaaattaat
tacgattgttggaaaggatcaggtttaattcaacagtggatggaaaacgaaaaatataca
agttttgataatttaacaatgtattttgaagagcaggtttttaataaattaatagattta
ggaaaaacacctattgtttgggaagagactttcgatgtatttggaactaaattatctaaa
gatgttatagttcaagtttatcattcaccaacactagcaaaatcaacaacaggtaatgga
tataaaacattactatctccagcagatttttattacttagaattagaatactcaagttgg
caaagagcatattcattcgaaccaactagtgtaattagccaagataatatagatttactt
ttaggtggagagggtgctttgtggaccgatactattggtgtaagtcaaattatttctaaa
atatatccatctgcaagttcaatcgctgaaaaactatggagccctattaatattaacaat
accgacattgctgaatatcgtctcgaatcattccactgttctttaattttccgaggtata
aatagtaataatgtattatcaacatcaataaaaaatttaaaatcatgcagtaaaagttaa

DBGET integrated database retrieval system