KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_96852Help
Entry
DICPUDRAFT_96852  CDS       T02090                                 

Definition
hypothetical protein
Orthology
K08850  
aurora kinase, other [EC:2.7.11.1]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Brite
Enzymes [BR:dpp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     DICPUDRAFT_96852
Protein kinases [BR:dpp01001]
 Serine/threonine protein kinases: Other group
  Aur family [Table]
   DICPUDRAFT_96852
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 359 aa AA seqDB search
MSSFTNKENVSNNTSFSNQNKQPQRVLQQNNNVTNTTATTKSTITKTTSASSTPSTSTPS
TSTPTSTSTSSSNSGPKKKWCIDDFDIGKLLGMGRFGHVYLAREKKSQFIVALKVLFKYQ
LQTHNIEHQLRREIEIQSHLRHPNILRLFGYFYDEKRVFLIIEFAKGGECFKELQKVGSF
NEMTAATYTLQIADALRYCHSKHVIHRDIKPENLLIGINGEIKIADFGWSVHAPNTKRNT
FCGTLEYLPPEVVENKGYDQTADVWSLGILIYEFLVGHSPFASDEEQRIFNNIKENEVHY
PSAISTDAKDLISKLLISDPHQRISLKDVINHPWIQKNAHPHSLEPTKLGLPLPSQMTH
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgagtagttttacaaataaagaaaatgtttcaaataacacatcattttcaaatcaaaac
aagcaaccacaaagagtactacaacaaaacaataatgtaacaaatactactgcaacaaca
aaatcaaccataacaaaaactacctctgccagttcaactccatcaacatcaactccatca
acatcaactccaacatcaacatcaacatcctcttcaaactcgggtccaaaaaagaaatgg
tgcatcgatgattttgatattggtaaattattaggtatgggcagattcggtcatgtatat
ttagcaagagaaaaaaagagtcaatttattgtggctttaaaagttttatttaaatatcaa
ttacaaacccataatatagagcatcaattaagaagagaaattgaaattcaatcccattta
agacatccaaatattttaagactatttggttatttttatgatgaaaaaagggttttctta
attatcgaatttgctaaaggtggcgaatgtttcaaagaattacaaaaagttggttcattt
aatgaaatgaccgctgctacatatacattacaaattgcagatgctcttagatattgccat
tctaagcatgttatacatagagatattaaaccagaaaatttattaattggcataaatggt
gaaataaaaatagcagattttggatggagtgttcatgccccaaatactaaaagaaataca
ttctgtggaacacttgaatatttaccaccagaagttgttgaaaataaaggttacgatcaa
actgcagatgtatggagtttgggtattttaatttacgaatttttagttggccactcacca
tttgcatcagacgaagagcaaagaatttttaataatattaaagaaaatgaagtacattac
ccatcagcaatatcaacagacgcaaaagatttaatttcaaaattattaatttcagatcca
catcaaagaatatccttaaaagatgttattaatcatccatggattcaaaaaaatgcccat
cctcactcattggagcctactaaattaggtttacctctcccatcacaaatgactcattaa

DBGET integrated database retrieval system