KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_99600Help
Entry
DICPUDRAFT_99600  CDS       T02090                                 

Definition
(RefSeq) hypothetical protein
  KO
K03245  translation initiation factor 3 subunit J
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
dpp03013  RNA transport
Brite
KEGG Orthology (KO) [BR:dpp00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    DICPUDRAFT_99600
Ribosome biogenesis [BR:dpp03009]
 Eukaryotic Type
  Pre-40S particles
   Other pre-40S particles
    DICPUDRAFT_99600
Translation factors [BR:dpp03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    DICPUDRAFT_99600
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF3_subunit
Motif
Other DBs
NCBI-GeneID: 10510944
NCBI-ProteinID: XP_003293246
JGI: Dicpu1_99600
UniProt: F1A0Q3
Position
Unknown
AA seq 222 aa AA seqDB search
MSDWSELNKEQWAEEGRAVDDLKDAWDDEEEVEEVEEEKVEEKKPEKPAVKQLTKKEALK
KAIELKEKEEKESRNNPASEFDIYMEEKRRKELQEAADLENSRTLFSGVSVRETTPSEPI
GSFVPKTEKEFEKYADIVSDYLTKYDSSIHYASFFKHLIKKSLANVPSNELNDISKALTV
VINEKIKNEKAGKGKKTTKATAKKSLQMGSELENYDDFDDFM
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgagtgattggagtgaattaaataaagaacaatgggctgaagaaggtagagccgttgac
gatttaaaagatgcttgggatgacgaagaagaagtagaagaagttgaagaagaaaaagtt
gaagaaaagaaaccagaaaaaccagctgttaaacaattaacaaagaaagaagctttaaag
aaagctattgaattaaaagaaaaagaagaaaaagaaagtagaaataacccagcttcagaa
tttgatatctatatggaagaaaagagaagaaaggaattacaagaagcagcagatttagaa
aacagtagaactcttttctctggtgtttcagttagagaaaccaccccatctgaaccaatt
ggttcatttgtcccaaaaactgaaaaggaatttgaaaaatatgctgatattgtttctgat
tatttaactaaatacgattcatcaattcattatgctagtttctttaaacatttaattaaa
aaatcattagctaatgttccatcaaatgaattaaacgatatttcaaaagctttaactgtt
gttattaacgaaaaaattaaaaatgaaaaagcaggaaaaggaaagaagacaaccaaagcc
actgccaagaaatcactccaaatgggcagcgaactcgaaaactatgatgatttcgatgac
tttatgtaa

DBGET integrated database retrieval system