KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_99718Help
Entry
DICPUDRAFT_99718  CDS       T02090                                 

Definition
protein phosphatase 2B
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Brite
Protein phosphatases and associated proteins [BR:dpp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     DICPUDRAFT_99718
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 184 aa AA seqDB search
MGNNQSLMSKEQLDQMKDSTSFSEAELKRLYRRFQMLDKDGSGTLTTDEFLSIPDLALNP
LLERVIQIFDQNKDNEIEFSEFVSTLGTLSHKGTKEDKLKFLFQIYDMDCDGYISNGELF
QVLKMMVGTNLNDVQLQQIVDKTIIEGDFDKDGRISFDEFLHMIGNQEGIEEKLSVNWSD
PSSN
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgggaaataatcaatcactcatgagtaaagaacaattagaccaaatgaaagacagcaca
agtttttcagaagctgaacttaaaagattatatagaaggtttcaaatgttagataaagat
gggtcaggtacactaacaactgacgaatttttatccatcccagatttagcattaaaccct
ttattagaacgtgtaattcaaatttttgatcaaaataaagataatgaaattgaattttca
gaatttgttagtacattaggaacactttcacacaaaggaactaaagaagataaattaaaa
ttccttttccaaatttatgatatggattgtgacggatacattagtaatggtgaattattc
caagttttaaagatgatggttggcacaaatttaaatgatgtacaacttcaacaaattgta
gataaaactattattgagggcgattttgataaagacggtagaatttcatttgatgaattc
cttcatatgattggtaaccaagaaggtattgaagaaaagctcagtgtaaattggtcagat
ccatcctcaaactaa

DBGET integrated database retrieval system