KEGG   Desulfobulbus propionicus: Despr_0048Help
Entry
Despr_0048        CDS       T01413                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
dpr  Desulfobulbus propionicus
Pathway
dpr00010  Glycolysis / Gluconeogenesis
dpr00052  Galactose metabolism
dpr00500  Starch and sucrose metabolism
dpr00520  Amino sugar and nucleotide sugar metabolism
dpr00521  Streptomycin biosynthesis
dpr01100  Metabolic pathways
dpr01110  Biosynthesis of secondary metabolites
dpr01120  Microbial metabolism in diverse environments
dpr01130  Biosynthesis of antibiotics
dpr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dpr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Despr_0048
   00052 Galactose metabolism
    Despr_0048
   00500 Starch and sucrose metabolism
    Despr_0048
   00520 Amino sugar and nucleotide sugar metabolism
    Despr_0048
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Despr_0048
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Despr_0048
Enzymes [BR:dpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Despr_0048
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase Phage_TTP_11 Pan_kinase DUF3520
Motif
Other DBs
NCBI-ProteinID: ADW16242
JGI: Despr_0048
UniProt: E8RHB6
Position
47737..48765
Genome map
AA seq 342 aa AA seqDB search
MTKHKGLLLAGDIGATKTVLALYETWPGQPLRQQTFRNAEFASFDELVERFLGAGAATPT
AACLGVAGPVTADTVRMTNLDWKIEAAALKQRFGWSQVRLINDLVATAMGALQLQPADCT
LLNPGEPREGAVMAVLAPGSGLGEAFLLPHRGGYLPFPSEGGHASFAPCNGEQIDLLTFM
FRHHAHVSVEQVCSGLAIPELFAFMATRQPVPDWLRQELIRAEDQTPVIVGAALAAIQGG
RMCEVAVRTLELFVDILADEAANLALKTLALGGIFLGGGLAPRLQPFLERQRFLAAFARG
NYRDMLGRIPVRIIRNPHTALLGAAACGASLVAGHDHQPLRC
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagcacaagggactgttactcgccggcgatatcggcgccaccaagacggtgctc
gccctgtacgagacctggcccggccagccgctgcgccagcaaaccttccgcaatgcggag
tttgccagtttcgacgagttggtggagcggtttctcggtgcgggagcggccacgcccacg
gcggcctgtctgggcgtggcggggccggtgaccgccgatacggtcaggatgaccaatctt
gactggaagatcgaggccgcagccctcaaacagcgattcggctggagccaggtccggttg
atcaacgacttggtggccacggccatgggcgcccttcaactgcagcccgccgattgcacc
ctgctcaacccgggcgagccccgggaaggggcggtgatggccgttctggctccgggaagc
ggcttgggggaggccttccttttgccgcatcgtggcggctacctcccctttccctcggaa
ggaggccacgccagttttgccccgtgcaatggcgagcagatcgatctgctcacctttatg
ttccgccaccacgcccatgtgtcggtggagcaggtgtgttccggtctggccatccccgaa
ctgtttgccttcatggccaccaggcagccggttcccgattggctgcggcaggaattgatc
cgggccgaggatcaaacgccagtgatcgttggcgcggccctggcggcgattcagggaggc
cggatgtgtgaggtcgccgtgcgtaccctggagctgtttgtcgacatcctcgccgacgag
gcggccaatctcgccctcaagaccctggcacttggcggcattttccttggcggcggtctg
gcgcctcggctgcagcctttcctggaacggcagcggtttttggccgcctttgcccggggg
aactatcgcgacatgctcggccgcatcccggtgcggatcatccgcaacccccataccgcc
ctgctgggtgccgcggcctgcggggcaagccttgttgccggccacgatcatcagccgctg
cggtgctga

DBGET integrated database retrieval system