KEGG   Desulfobulbus propionicus: Despr_0048Help
Entry
Despr_0048        CDS       T01413                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
dpr  Desulfobulbus propionicus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dpr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Despr_0048
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Despr_0048
   00052 Galactose metabolism
    Despr_0048
   00500 Starch and sucrose metabolism
    Despr_0048
   00520 Amino sugar and nucleotide sugar metabolism
    Despr_0048
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Despr_0048
   00524 Butirosin and neomycin biosynthesis
    Despr_0048
Enzymes [BR:dpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Despr_0048
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
47737..48765
Genome map
AA seq 342 aa AA seqDB search
MTKHKGLLLAGDIGATKTVLALYETWPGQPLRQQTFRNAEFASFDELVERFLGAGAATPT
AACLGVAGPVTADTVRMTNLDWKIEAAALKQRFGWSQVRLINDLVATAMGALQLQPADCT
LLNPGEPREGAVMAVLAPGSGLGEAFLLPHRGGYLPFPSEGGHASFAPCNGEQIDLLTFM
FRHHAHVSVEQVCSGLAIPELFAFMATRQPVPDWLRQELIRAEDQTPVIVGAALAAIQGG
RMCEVAVRTLELFVDILADEAANLALKTLALGGIFLGGGLAPRLQPFLERQRFLAAFARG
NYRDMLGRIPVRIIRNPHTALLGAAACGASLVAGHDHQPLRC
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagcacaagggactgttactcgccggcgatatcggcgccaccaagacggtgctc
gccctgtacgagacctggcccggccagccgctgcgccagcaaaccttccgcaatgcggag
tttgccagtttcgacgagttggtggagcggtttctcggtgcgggagcggccacgcccacg
gcggcctgtctgggcgtggcggggccggtgaccgccgatacggtcaggatgaccaatctt
gactggaagatcgaggccgcagccctcaaacagcgattcggctggagccaggtccggttg
atcaacgacttggtggccacggccatgggcgcccttcaactgcagcccgccgattgcacc
ctgctcaacccgggcgagccccgggaaggggcggtgatggccgttctggctccgggaagc
ggcttgggggaggccttccttttgccgcatcgtggcggctacctcccctttccctcggaa
ggaggccacgccagttttgccccgtgcaatggcgagcagatcgatctgctcacctttatg
ttccgccaccacgcccatgtgtcggtggagcaggtgtgttccggtctggccatccccgaa
ctgtttgccttcatggccaccaggcagccggttcccgattggctgcggcaggaattgatc
cgggccgaggatcaaacgccagtgatcgttggcgcggccctggcggcgattcagggaggc
cggatgtgtgaggtcgccgtgcgtaccctggagctgtttgtcgacatcctcgccgacgag
gcggccaatctcgccctcaagaccctggcacttggcggcattttccttggcggcggtctg
gcgcctcggctgcagcctttcctggaacggcagcggtttttggccgcctttgcccggggg
aactatcgcgacatgctcggccgcatcccggtgcggatcatccgcaacccccataccgcc
ctgctgggtgccgcggcctgcggggcaagccttgttgccggccacgatcatcagccgctg
cggtgctga

DBGET integrated database retrieval system