KEGG   Desulfobulbus propionicus: Despr_0249Help
Entry
Despr_0249        CDS       T01413                                 

Definition
G-D-S-L family lipolytic protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
dpr  Desulfobulbus propionicus
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:dpr00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Despr_0249
Enzymes [BR:dpr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Despr_0249
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Despr_0249
Lipid biosynthesis proteins [BR:dpr01004]
 Fatty acid synthase
  Component type
   Despr_0249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
238912..239562
Genome map
AA seq 216 aa AA seqDB search
MEWMRGVLVVMVLTACGAGNAWAERVILFLGDSLTAGLGVEAEQAYPRLLGEMLARDGIS
DVRIVNGGISGSTSAGALARLRWYQQITPSILFLALGANDGLRGLTMEEMARNLNAVIEA
AKARGMRVILAGMELPPNYGQEYTAAFRHVYHDLAARHGLPLIPFLLEGVGGVPALNQAD
GIHPNAEGHQRIARHVYPTLKACVKTAGERPEAGKP
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggagtggatgcgtggtgttcttgtggtgatggtgttgacggcttgcggggccggaaac
gcctgggcggaacgggtgatcctgttccttggcgattcgctgaccgctggtctcggggtg
gaggcggagcaggcctatccccggctgctcggcgagatgctggccagggacggcatctcg
gacgtgcgcatcgtcaacggcgggatcagcggatccacctcggccggcgccctggcgcgg
ctgcgctggtaccagcagatcaccccttcgatcctcttcctcgccctgggggccaatgac
ggcttgcgcggcctgaccatggaggagatggcgcgcaacctgaacgcggtgatcgaggcc
gccaaggcgcggggaatgcgcgtcatcctcgccggcatggagctgccgcccaattacggc
caggaatacaccgccgcctttcgccacgtgtaccacgacttggccgcccggcatggcctg
cccctgatcccttttctcctggagggggtcggcggggttccggccctcaaccaggccgac
ggcattcatcccaacgccgaagggcatcagcggatcgcccgccatgtctaccccacgctc
aaggcctgcgtgaaaacggcaggggaacgccccgaggcgggcaaaccatga

DBGET integrated database retrieval system