KEGG   Desulfobulbus propionicus: Despr_0319Help
Entry
Despr_0319        CDS       T01413                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dpr  Desulfobulbus propionicus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dpr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Despr_0319
   01230 Biosynthesis of amino acids
    Despr_0319
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Despr_0319
   00051 Fructose and mannose metabolism
    Despr_0319
   00562 Inositol phosphate metabolism
    Despr_0319
Enzymes [BR:dpr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Despr_0319
Exosome [BR:dpr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Despr_0319
  Exosomal proteins of bladder cancer cells
   Despr_0319
  Exosomal proteins of melanoma cells
   Despr_0319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
319610..320287
Genome map
AA seq 225 aa AA seqDB search
MKKILLANWKANLSPERAMQWCEVFAATYRPHADLEMVVAVPSLMLERVAAHLRGRDGIA
LAAQGVSPYPQGNYTGSTPAAWLRGLVRYTLIGHRERRRYFHETVQDVARQAYESLAEEL
QPIVCVDRELLIPQTAAMAAEELPRLIWAYTPETPKTLEMARSEREIVALLPQIARSTDN
GPVLYGGGVTVDNAASLWQLAGISGLLMGRGCLDAAVFAALINRL
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatactgctggccaactggaaggccaatctttcgccggaacgggcgatgcag
tggtgcgaggtgttcgccgccacctatcggccgcatgccgatctcgagatggtggttgcc
gtgccgtcgttgatgctggaacgggttgcggcacatctgcgggggcgcgatggcattgcc
ctggccgcgcagggggtttctccgtatccgcagggcaactataccggttccacaccagcc
gcatggctgcgcgggctggtgcgctataccctgattggccatcgcgagcgacgacgctat
ttccacgaaaccgttcaggatgtggccagacaggcctatgaatcgctggcggaagagctg
cagcctatcgtctgcgtggaccgggaacttttgatcccgcaaaccgcagccatggccgcc
gaggagttaccccgcctgatctgggcctatactccggaaacgcccaaaactttggagatg
gcacggagcgaaagggagatcgtcgccctgctgccgcagatcgcccggagcaccgacaat
ggtccggtactttacggtggcggggtcacggttgacaatgccgcctcgctgtggcagctt
gccggaatcagcggcctgttgatgggacggggctgcctggatgccgcagtctttgccgcc
ctgatcaaccgtttgtga

DBGET integrated database retrieval system