KEGG   Desulfobulbus propionicus: Despr_0334Help
Entry
Despr_0334        CDS       T01413                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
dpr  Desulfobulbus propionicus
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dpr00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Despr_0334
Enzymes [BR:dpr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Despr_0334
Peptidases [BR:dpr01002]
 Cysteine Peptidases
  Family C44
   Despr_0334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
336459..338348
Genome map
AA seq 629 aa AA seqDB search
MCGIAGATRNLLGSDPHQTLHWMNDAMLHRGPDMGEIHLDEAIGLCHRRLSIIDLSEDGR
QPMSSSDGRFAIVFNGEIYNFPALRKELEKKGHLFRSRTDTEVLLALYQEEGTIGLQKIR
GMYAYAIWDKEKKELFAARDRIGKKPLYFFHDGDRFAFASEIKSLLAIPSIKPKFDPTAL
VDYLKYLFIPHPKSIYSNIHKLAPGHFLLFKNGRVHIEEYWDVDFSETSNASEEELTEEL
LTIIEEAVQCRLLSDVPLGAFLSGGIDSSGVVALMNRLQPDPVITCTIGFKDKSYNEAEE
AKTFAFSLGARHHEYYVEDEPAQVIKKLVWHFDEPFADSSMVPTYYVSQMARKNVTVALS
GDGGDENFAGYGKYAIDQFENRVRQHVPSPLLRLLASFSGSMLSGSRVGKKLHSLSSSAL
LSPAQGFYVTNTFISDSQLQTLLAPELLAQVRDYDPAGHILGYYNRAHGPDHLAAILYTD
LKLLLPGDFLVKVDRMSMANSLEVRSPLLDQKVIEFAARIPSRFKLHGREKKYILKNALR
GVLPSQVLQRKKHGFESPINKWFRHELRSMAETYLLYNEAMASFFNIHAIKQLWEQHQTG
KQDHGTLLWTLFVFALWQEQWIAGGAVHV
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatagccggggcaacccggaatttgttagggagtgatcctcatcaaactctc
cactggatgaatgatgccatgctgcatcgaggtccggacatgggagagatccatttggac
gaggccatcggcctttgtcatcgtcgcctgtcgatcatcgatctcagcgaagacggcagg
caacctatgtcgagcagtgatggtcggttcgccattgtgtttaatggcgaaatttataat
tttcctgccttgcgcaaggagcttgagaagaaaggtcatctttttcgcagtagaaccgac
accgaagttctattggcgctttatcaggaagaaggcacgattggcctgcagaaaatcagg
ggcatgtacgcctatgccatttgggacaaggaaaaaaaagagctatttgcggctcgagac
cgtatcggcaaaaaaccgctctatttttttcatgacggtgacaggttcgcctttgcctcg
gaaatcaaatccttgcttgccatcccttcaatcaagcccaaatttgaccccaccgccttg
gttgattatcttaaatatctctttatccctcatccaaaaagcatttacagcaatattcac
aaactcgctcctgggcattttctgctgttcaaaaatggcagggtccatatcgaggagtat
tgggatgttgatttttccgaaacgagcaatgcaagtgaagaggaattgaccgaagagttg
ctgacgatcatagaagaagcggtgcaatgccgattgctttccgatgtcccgctgggggcg
ttcttgagcggcgggattgattcctccggtgtggtggccttgatgaacaggttgcagccg
gacccagtcataacctgcactatcggttttaaggacaaatcctataacgaggcggaagag
gccaagacgtttgccttctccctgggggccaggcaccatgagtattatgtggaggatgag
ccggctcaggtgatcaaaaagctggtgtggcattttgatgagccttttgccgactcatcc
atggtaccgacctattacgtttcgcaaatggcccgcaaaaatgtgaccgttgccttgtca
ggcgatggaggcgacgaaaattttgccggctacggaaaatacgccatcgatcagtttgaa
aacagagttcgacagcacgtaccgtctccccttcttcgcctgcttgcctcattttccggt
tcaatgctctccggaagcagggtggggaaaaagctccactcccttagttcgtccgccctg
ttgagtccggctcagggattttatgtcaccaatacctttatcagcgacagccagttgcag
acgctgcttgccccggagttgttggcacaggtcagggactacgatccagctgggcatatc
cttggttattacaatcgggcccatgggccagatcatcttgctgctattctctacacagat
cttaaattgctgctccctggcgactttcttgtcaaggtagataggatgagcatggccaat
tccctggaagtccgatcaccgcttctcgatcaaaaagtgatcgagtttgccgctcgcatt
ccctctcggttcaagctgcacggccgcgaaaaaaaatatatcctgaaaaatgcgttgcgc
ggtgttttgccatcacaggtcctgcagcgcaaaaaacacggattcgaatctcccatcaac
aagtggttccgccacgaattgcgttcaatggccgaaacgtatcttctgtacaatgaggcc
atggcctcatttttcaacatccatgccatcaagcaactatgggagcaacaccagaccggc
aagcaggaccacggcaccctcctgtggaccctatttgtctttgccctctggcaagaacag
tggattgcaggcggtgctgttcatgtttga

DBGET integrated database retrieval system