KEGG   Desulfobulbus propionicus: Despr_0645Help
Entry
Despr_0645        CDS       T01413                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
dpr  Desulfobulbus propionicus
Brite
Enzymes [BR:dpr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Despr_0645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
695114..695767
Genome map
AA seq 217 aa AA seqDB search
MSPPSTFDINRERMIEEQLVARGITDQRVLEAMRTVPRHLFVEDAIRAQAYGDFPLPIGS
GQTISQPYVVALMTLALRLTGSEKVLEIGTGSGYHAAVLSRLCQRVYTVERIDGLVSRAR
KVFDRLRYHNIVSRIDDGTVGWPSEAPFDAIVVTAGGPRVPEPLIAQLADPGRLIMPVGG
QDVQELQLVEKHEGSVRVTTIEQVRFVDLIGAYGWPN
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
gtgagcccaccctcgacctttgacatcaatcgcgagcggatgatcgaggagcagctggtt
gcccgggggatcaccgatcagcgggtgctggaggccatgcgcaccgtgcctcggcatctg
ttcgtcgaggacgccatccgggcccaggcctacggggatttccccctgcccatcggcagc
ggccaaaccatctcccagccctacgtggtcgccctcatgaccctggccctgcgcctgacc
ggctcggaaaaggtgctggagatcggcaccggttccggctaccacgcggccgtcctctcc
cgcctctgtcagcgggtgtacacggtggagcggatcgacggcctggtcagccgggcgcgc
aaggtgtttgaccggctccgctaccacaacatcgtctcgcgcatcgacgacggcaccgtg
ggctggccttccgaagcccccttcgacgcgatcgtcgtcaccgccggcggtcctcgggtt
cccgagcctctgatcgcccagctggccgatccgggccggctgatcatgccggttggcggc
caggacgtgcaggaactgcaattggtggagaaacacgagggcagtgtcagggtgaccacc
attgaacaggtgcgtttcgtcgacctgatcggcgcctacggctggcccaactaa

DBGET integrated database retrieval system