KEGG   Desulfobulbus propionicus: Despr_0690Help
Entry
Despr_0690        CDS       T01413                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K15792  
murE/murF fusion protein [EC:6.3.2.13 6.3.2.10]
Organism
dpr  Desulfobulbus propionicus
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpr00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Despr_0690
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Despr_0690
Enzymes [BR:dpr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.10  UDP-N-acetylmuramoyl-tripeptide---D-alanyl-D-alanine ligase
     Despr_0690
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Despr_0690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
752270..755305
Genome map
AA seq 1011 aa AA seqDB search
MITLAKLVQAIAPGANRRLSGTVLAQPVTAITSDSRQVVPGSLFVAVRGVKTDGRRYIPE
AIGKGCLAVVVDVDEGVDEWNVPVLLVDDCPAALGELAAAWNGYPASQMQLVAITGTNGK
TTCSWLIEEMLVASGFRPGVIGTVNYRYHGADGLHIIQDAPLTTPDPVTLQGLLRTMADN
GVTHVIMEVSSHALQQQRLGSTRFDVALFTNLSRDHLDYHQSMEVYFEAKKQLFHKHLKE
QGVAVVVLGPQAEGCDWGGLLTASLPAEQVIRCGLHGSCEVSAHQLTQTMEGFRCCLHLR
GAEVNFASPLTGEYNVLNVLAAAGVGLGLGLVPDRFLEGLARVGRVPGRLERVRLPGEQI
GSGPAVFVDYAHTPDALDNVLRNLKKLTTGRLLCVFGCGGDRDRGKRPLMGRVAAQLADA
VVVTSDNPRTEAPEAIIDEIVAGVEAGGKSRTDAWALLNAAQPVDGYTVIADRRCAITAA
CSLAAPGDSVLLAGKGHETYQIIGTEKHFFDDRQEATNGLLHWNERHLLAATSGKVAGGT
LCRVLASVCTDSRQLRPGDIFVALKGEAFDGHQYIEAAAEQRAGAIVAEWMPPRMRPEVL
YIEVKDSLRALGDLAAYRRRLLNGTIKVAAITGSSGKTTVKEMVASIFAEALQGSRTGMD
AVLKTRGNFNNLVGLPLSLLPLEAGHRLAVVEMGMNVPGEIARLVAIADPDIGCINNVHP
AHLQGLGSLAGVAAAKGELFAGMRPEAVRVVNLDDPHVRAQAKKFAGEQIGFAVTPSGRK
FGPQVRATRPDNLGEQGMRFTLHIEGWRARVTVPVFGAHNVSNCVAAAAIAHAAGIGPEV
IAQGLQRYAPSVDKRLAVTELPGGLKVVNDAYNANPASMAAGLRTVAAFGHRGCRHLAAL
GDMLELGAASEDLHAGIGALVASLGYDFLALTGMQATVMARAASAAGMKEENIRVFANPR
AMADWIYPMLARGDLAAGDWLLIKGSRGMRMEQLLDELEQRLNNSKKNVTE
NT seq 3036 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccttggcaaaacttgtgcaggccatcgcccctggggcgaaccggcggctttcg
ggaaccgtgctcgcacagcctgtgacggcgatcacctcggattcacggcaggtcgttccg
ggaagcctctttgtcgccgttcgtggagtaaagacggatggccgccgctatattccggag
gcgatcggcaaagggtgtctggctgtggtggtcgatgtcgatgagggggttgatgagtgg
aatgttccggtgctcctggtcgacgattgtccagccgcgcttggtgaactggccgctgcg
tggaacggttatccggccagccagatgcaattggtggccatcaccggcaccaatggcaag
accacctgttcgtggctgatcgaggagatgctggtcgcctccggcttccgccccggagtg
attggaacggtcaactaccgctatcacggtgccgacggcctccatatcatccaggacgcc
cccctgaccacccccgatccggtgaccttgcagggattgcttcgcaccatggccgacaac
ggtgtgacgcatgtgatcatggaggtttcctcacacgccctgcaacagcagcgtctgggc
tcgacccgcttcgatgtggccttgttcaccaaccttagccgtgaccatctcgattatcac
cagtcgatggaggtctatttcgaggcaaagaaacagctctttcataagcatctcaaggag
caaggcgtagcggtggtggtgctggggccacaggcggaggggtgcgactggggcggcctg
ctgacggcgtcactgccggcggagcaggtcattcgctgcggtttgcatggttcgtgcgaa
gtgagcgcgcatcaattgacccagaccatggaggggtttcggtgctgcttgcatctgcgg
ggcgcggaggtgaactttgcttcgccgttgaccggggaatacaatgtgctcaatgtgctg
gctgcggcgggcgttggactggggttgggcctggtgccggatcggtttcttgagggattg
gccagggtggggcgggtacccggccgcctggaacgggttcgattacctggtgagcagata
ggatcggggcccgctgtgtttgtcgattatgcccatactccggatgccttggacaatgtg
ttgcgcaatctgaaaaaactgaccaccggacgtttgctttgcgttttcggttgcggcggc
gaccgtgatcgcggcaagcggccattgatgggcagggttgcggcccagttggccgacgcg
gttgtcgtgacctccgacaatccacgcaccgaggcgccggaggccatcatcgacgagatc
gttgccggtgtggaggccggcggcaagtctaggaccgacgcttgggcgttgctgaacgct
gcacagccggttgatggttacaccgtgattgccgatcgcaggtgtgccataacagcggcg
tgcagccttgccgctcccggtgacagcgtcctgctcgccggcaaggggcatgaaacctac
cagatcatcggcacggaaaagcatttttttgatgatcgccaggaagcgaccaacggcctg
ctgcactggaacgagcgccatctgcttgccgccacgagcggcaaggttgccggcggcacg
ctctgtcgtgtattggcctcggtgtgcaccgattcccgccagctgcgaccaggagatatt
ttcgtggcgctcaagggagaggcctttgacgggcaccagtatatcgaagccgctgccgaa
cagagggccggcgccattgtcgccgagtggatgccgccacgcatgcgtccggaggttctg
tatatcgaggtcaaagacagtctgcgcgccttgggcgatctggcagcctaccgacgtcga
ttgctgaacggcacgatcaaggtggcggccatcaccggcagttcggggaaaaccacggtc
aaggaaatggtggccagcatctttgccgaggcgttgcagggcagccgcaccggaatggac
gccgttcttaaaaccagaggcaacttcaacaatctggtcggactgcctctgtcgctgctg
ccgctggaggccggtcaccggctcgcggtggtggagatggggatgaatgttcccggcgag
attgcccggctggtggccatcgctgatccggatatcggctgcatcaacaacgttcaccca
gcccatctccagggactgggcagtcttgccggagtggctgcggccaagggagagctcttc
gccggcatgcggcccgaagcggtgcgggtagtcaacctcgatgatccccatgtccgggcg
caggccaaaaaatttgctggcgaacagattggttttgcggtaactccttccggccgcaaa
tttggaccacaggtccgggccacccgcccggacaatctgggtgaacagggcatgcgcttt
accctgcacatcgaagggtggcgggcgcgcgtgaccgtgccggtctttggcgcccacaat
gtcagcaactgcgtcgccgccgcggccatcgcccatgccgcaggtatcggacccgaggtc
attgcccagggcctccagcggtatgctccgtcggtggacaagcgattggcggtcaccgaa
ctgccgggagggctgaaggtcgtcaacgacgcctacaatgccaatcccgcctcgatggct
gcggggttgcgcaccgtggccgccttcggccacaggggatgccggcatctggccgctctg
ggcgacatgctcgagctgggtgccgcttccgaagatctgcacgccgggataggcgccctg
gtggcgagcttggggtatgattttctggccttgaccgggatgcaggcgaccgtgatggcg
cgagccgcgagcgccgcgggtatgaaggaggaaaacatccgggtgtttgccaatccccgc
gccatggccgactggatctatccgatgctggcccgaggggacctggccgccggcgactgg
ctgttgatcaaggggtcgcgcggcatgcgcatggagcagctcctcgatgaactggagcaa
cgcttgaataattcaaagaaaaacgtaacggaataa

DBGET integrated database retrieval system