KEGG   Desulfobulbus propionicus: Despr_0822Help
Entry
Despr_0822        CDS       T01413                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
dpr  Desulfobulbus propionicus
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:dpr00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
901160..902314
Genome map
AA seq 384 aa AA seqDB search
MKALSLLGSTGSIGTNVLAVVRQFPEQFRIVGLAAGRNVALLAEQVLEFQPECISVAEPA
LVSPLAQRLPPSYHSRIVCGTEGNCAVASLASAHMVVSAVVGAIGLLPALTAIRAGKDVG
LANKETLVMAGRLVMRSAQQHKVQLLPIDSEHSAIFQALEAGRKQDVARIILTASGGPFR
TWSKDDLATAAPAQALAHPNWSMGRKISIDSATLMNKGLEVIEARWLFDVEPEQIEVVVH
PQSIVHSLVEYQDGSVVAQLGIPDMRIPIAYALSYPKRLELGLSRLDLAQCGGLAFEQPD
HERFPALRMAYDALAMGGVKPAVLNAANEVAVEAFLNGRIGFTRIAEVVDRALQETAQGD
ELDLDAILAADQAARAMVTRALQA
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgttatccttgctgggatcgaccgggtccatcggcaccaatgtgctggcggtg
gtgcgacagtttcccgaacagttccggattgtaggccttgcggccggccgcaatgtcgcc
ctgttggccgagcaggtgctggagtttcagccggaatgcatttcggtggctgagccagcg
ttagtctcccctcttgcacaacggctgcccccgtcctatcattcccgtatcgtttgcggg
accgagggcaactgcgcggtggcctcgctagcctctgctcacatggtggtttctgccgtg
gttggtgcgattggcctgctgccagccttgaccgccattcgggctggcaaggatgtgggc
ctggccaacaaggaaaccttggtcatggctggtcgactggtgatgcggtctgcacagcag
cataaggttcagttgctgcccattgattccgaacacagcgccatctttcaagccttggag
gctggacgcaaacaggacgtggcccggattattctcaccgcctccggtggtccgtttcgg
acctggagcaaggacgatctggcaaccgctgcccccgcgcaggctcttgcccaccccaat
tggagtatggggcgcaagatctccatcgattccgcaacgttgatgaacaaggggcttgaa
gtaatcgaggcccgctggctttttgacgtcgaacctgagcaaatcgaggtagtggtgcat
ccgcaatcgattgttcattcactggtggaatatcaggacggttcggtggttgcccagtta
gggatcccggatatgcggatccccatcgcctatgcgctgtcctatcccaagcggcttgaa
ttgggcctttcacggcttgatctggcgcagtgcggtgggcttgcctttgaacaacccgat
catgaacgatttccggccctgcgcatggcctatgacgccttggcaatgggcggcgttaaa
ccggctgttcttaatgccgccaacgaggttgccgtcgaggccttcctcaacggccggatt
ggtttcacccgcatcgccgaagtggttgacagggctttgcaggagaccgcccaaggggat
gaactggacctggacgccattctcgcggctgaccaggcagcccgtgccatggtcacccgt
gcgctccaggcctga

DBGET integrated database retrieval system