KEGG   Desulfobulbus propionicus: Despr_0890Help
Entry
Despr_0890        CDS       T01413                                 

Definition
(RefSeq) L-threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
dpr  Desulfobulbus propionicus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dpr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Despr_0890
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Despr_0890
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Despr_0890
Enzymes [BR:dpr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Despr_0890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
985228..986619
Genome map
AA seq 463 aa AA seqDB search
MRYISTRGGIEPLQFQDAVMMGLARDGGLLLPQTLPTVDTEVLDRWQHLPYQYLAREILS
LFIDDIPQADLEDLIERAYASFAHPQVTPVTKRGDVYILELFHGPTLAFKDVALQLLGNL
FEYVLARTGGFMNILGATSGDTGSAAIAGVRGKNKINIFILHPHGRTSPIQALQMTTVLD
PNVFNIAVRGTFDDAQSIVKAIFNDLDFRDRYRLGAVNSINWARVLAQVVYYVYAYLKLR
KLGSGSVDFSVPTGNFGDIFAGYVAKTLLPAGCIHTLILATNANDILARFVSQGDYSRGQ
VQATSSPSMDIQIASNFERYLYYLRGEDGAAVKADMEGFAATGKLDLSAFTARVAQDFRS
RAVSEEETIATIGAFHREHGYLLDPHTAVGVKAALDLREPSRPVVCLATAHPAKFGEAVT
RAIGSEPPLPLALADLANRESRCVVLDAEVETVKEFVARNGLQ
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgcgctatatcagtacccggggcggcatcgagccccttcagtttcaggatgcggtgatg
atggggctggcccgggacggtggcctgcttttaccccagaccctgcccacggtcgatacc
gaggtgctcgaccgctggcagcatctgccctaccaatatctggcccgggagatcctctcg
ctgttcattgacgatatcccccaggccgatctggaagacctgatcgagcgggcctatgcc
tcctttgcccatccgcaggtgaccccggtgaccaaacggggggatgtctacatcctggag
ttgttccacggtccgacgctcgccttcaaggacgtggccctgcaactgctcggcaacctg
ttcgaatatgtgctggcccgcaccggcggcttcatgaacatcctcggcgccacctcgggc
gacaccggcagtgccgccattgccggggtgcgcggcaaaaacaagatcaacatcttcatc
ctgcatccgcacggccgcaccagccccatccaagccctgcagatgaccacggtccttgac
cccaacgtgttcaacatcgcggtgcgcggcacctttgacgatgcccagagtatcgtcaag
gccatcttcaatgacctcgattttcgcgaccgctaccggctgggcgcggtcaactcgatc
aactgggcccgggtgctggcccaggtggtgtactatgtctacgcctatctcaagttacgc
aaactgggatcgggcagtgttgatttttcggtgcccaccggcaacttcggcgacatcttc
gccggctatgtggccaaaacgctgcttcccgccggttgcatccacactctgatcctggcc
accaacgccaacgacatcctggcccgtttcgtcagccaaggcgactactcacggggacag
gtgcaggccaccagcagtccatcgatggacatccagatcgcatccaacttcgagcgctac
ctctattacctgcgcggcgaggacggcgcggcggtcaaggcggacatggaaggattcgcc
gccaccggaaaactggatctctcggccttcacggcacgggtggcccaggatttccgttcg
cgtgcggtgtccgaggaggagaccatcgccaccatcggcgcattccaccgggagcacggc
tacctgctcgacccgcacaccgccgtcggggtcaaggccgcgctcgacctgcgcgaaccg
agccggccggtggtctgtctggctaccgcccatccggccaaattcggtgaggcggtcact
cgggccatcggcagcgagccgcccctgccgctggccctggccgatttggccaaccgcgaa
agccgctgcgtcgtgctcgatgcggaggtcgagacagtcaaggaattcgtggccaggaat
ggactccagtga

DBGET integrated database retrieval system