KEGG   Desulfobulbus propionicus: Despr_0975Help
Entry
Despr_0975        CDS       T01413                                 

Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
dpr  Desulfobulbus propionicus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:dpr00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1098798..1100729)
Genome map
AA seq 643 aa AA seqDB search
MKREIPAGRAVPADWLSNFDRYLISEGTHERAYEKLGAHLVRFDGSDGVVFAVWAPNARQ
VSVIGDFNDWDPTRHPMHSSDTGIWTLFIPALHEFTVYKYHLTTHNNDQLDKADPFGFAM
EERPRTGSVVARLDGYPWQDGEWIAARQRHQALDRPISIYEVHLGSWRREADPQWGQRYL
TYRELADTLIPYVKEMGYTHIELLPIAEHPFDGSWGYQVLGFYAPTSRFGTPEDFMFFID
QCHAAGLGVILDWVPAHFPKDGAGLNNFDGTQLYAHANPLQGEHQDWGTLIFNYSRNEVR
SFLISNALFWIDKYHIDGLRVDAVASMLYLDYSREEGQWIPNEYGGRENLAAISFLRKVN
EVVHGIFPGVLTIAEESTSWPMVSRPTYLGGLGFSLKWNMGWMHDTLSYMAKDPLFRRFH
HNQMTFGMLYAFHENFVLPLSHDEVVHGKGSLLNKMSGDEWQKFANLRAYFGFMWGYSGK
KLLFMGCEFGQWQEWNHDTGLEWQALTAPRHQGLQRLVRDLNLVYQHTAALHEVDFDWSG
FRWIDANDSDNAVFSFVRYAKQADDFVVVVCNFTPVVRTDYRIGVPTAGPYRELINSDLH
IYGGSGVANGTDLIAQPVASHTFAQSLSLTLPPLATLILQPCP
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcgaaatcccagccggaagggcagttccggcggattggctgagcaacttcgac
cgttatttgatcagcgaaggcacccacgagcgggcctatgagaaattgggggcgcatctg
gtccgtttcgacgggagcgacggcgtggtcttcgcggtctgggccccgaacgcccgccaa
gtgtcggtgatcggcgacttcaacgactgggacccgacccgccacccgatgcattcctcc
gacacaggcatctggaccctgttcatccccgcgctccacgagttcacggtctacaaatac
cacctcaccacccataacaacgatcagctggacaaggccgaccccttcggctttgccatg
gaggagcggccgcgcaccggctcggtggtcgcacggctggatggctacccgtggcaggac
ggcgaatggatcgcggcccgccaacggcaccaggccttggacagaccgatctccatctat
gaagtccatcttggctcctggcggcgggaagccgatccccaatggggccaacgatatctc
acctaccgcgaattggcggataccctcatcccctatgtcaaggagatgggctacacccat
atcgagctgttgccgattgccgaacacccctttgacggctcctgggggtatcaggtcctc
ggcttttacgctccgacctcccgcttcggcacccccgaggacttcatgttcttcatcgat
cagtgtcatgccgccggtctgggggtgattctcgactgggtgccggctcacttccccaag
gatggcgccggcctcaacaactttgacggcacccaactctatgcccacgccaatcccctg
cagggcgaacatcaggactggggtaccctgattttcaactacagccgcaacgaagttcgc
tcctttctcatctccaacgccctgttctggatcgacaaatatcatatcgacggtctgcgg
gtcgatgcggtggcctccatgctctatctcgactattcccgcgaggaggggcaatggatt
cccaatgaatacggcggccgggaaaatctggcggccatcagtttcctgcgcaaggtcaac
gaggtggtgcacggcatctttcccggtgtgttgaccattgccgaggaatcgacctcctgg
cccatggtcagccgccccacctatctcggcggtcttggcttcagcctcaagtggaacatg
ggctggatgcacgacaccctgagctacatggccaaggatccgctgttccggcgcttccat
cacaaccagatgacctttggcatgctctatgctttccacgaaaattttgtcctgccgctc
agccacgacgaggtggtccatggcaaggggtccctgctgaacaagatgagtggcgacgag
tggcagaagttcgccaacctgcgcgcttatttcgggttcatgtgggggtattcgggcaag
aagctgctgttcatgggctgcgagttcggtcaatggcaggaatggaaccacgataccgga
ttggaatggcaagccctgaccgctccccggcatcagggactgcaacggctggtacgcgat
ctcaacttggtctatcagcacaccgccgccctgcatgaggtcgatttcgactggagcggt
ttccgatggatcgatgccaatgattccgacaacgccgtcttctcttttgtccgttatgcc
aagcaggccgacgattttgtcgtggttgtctgcaatttcaccccggtggtgcgcaccgac
taccgcatcggtgtccccacggctggaccgtaccgcgagctgatcaattccgatctgcac
atttacggcggcagcggtgttgccaacggcaccgatctgatcgcccagcccgtggccagt
catacctttgcgcagagtttgtccctgaccttgccgccgctggcaaccctgattctccaa
ccttgtccatga

DBGET integrated database retrieval system