KEGG   Desulfobulbus propionicus: Despr_1085Help
Entry
Despr_1085        CDS       T01413                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
dpr  Desulfobulbus propionicus
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:dpr01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:dpr00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1214951..1216126
Genome map
AA seq 391 aa AA seqDB search
MTFQVNKDDGLFYRQTLFDQAKRVVIKVGSAVLTDENGLDLNIIGNIARQVSFLQSTGRQ
VILVSSGAVAAGRKRLGVVKTAHEELRVKQALAATGQGLLMQAYEQAFADFNQPVAQVLL
THADLSHRGRYLNVRNTILTLFEFGVVPIINENDTVSAEELRFSDNDTLGALMTNMIGAD
MFIILTDVDSLYTGNPSVDPDARPIYTVASITRDIERMAGQSTSLVGTGGMMAKIRAAKM
VAACGSCSFIGPGRHPDILRALFSGELVGTFFLPGKGKINRRKHWIAYVLKPQGFLVVDD
GARRALVEQGKSLLPSGVTEVRGSFAIGAPVQCLDRSGAVIAAGLSNYASIDIERIKGKK
TREIEAILGGKDSDEIIHRDNLVIMGREGGQ
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgacctttcaggtgaataaggacgacggcctgttttaccgtcaaaccctttttgaccag
gccaaacgggtggtgatcaaggtcggcagcgccgtcctcaccgacgagaatggtctggat
ctcaacatcatcggcaatattgcccgccaggtttccttccttcagtccaccggccgtcag
gtgatcctggtcagctccggggcggtcgccgccggccgcaaacggctcggcgtggtcaag
acggcgcacgaggagctcagggtcaagcaggccttggccgccaccgggcaagggctgttg
atgcaggcctacgagcaggcctttgccgactttaaccagccggtggcccaggtgctgctc
acccatgccgacctgtcccaccggggccgctatctcaatgtccgcaataccatcctcacc
ctgtttgagttcggggtggtgccgatcatcaacgagaacgacacggtttccgccgaagag
ctgcgtttctccgacaacgataccctgggcgccttgatgaccaacatgatcggcgccgac
atgttcatcatcctcaccgatgtcgacagtctctacaccggcaatccctccgtggatccc
gatgcccggccgatctacaccgtggccagcatcacccgcgacatcgaacggatggccggt
cagtccaccagtttggtcggtaccggtggcatgatggccaagatccgcgccgccaagatg
gtggccgcctgcggcagctgctcgttcatcgggccggggcgccatccggacattcttcgc
gcactgttcagcggcgagttggtcggcacctttttcctgcccggcaagggcaagatcaac
cggcgcaagcactggatcgcctacgtgctcaaaccgcagggatttctcgtggtcgacgac
ggtgcccgccgggccctggtggagcagggcaagagcctattgccctccggggtgaccgag
gttcggggcagtttcgccatcggcgcgccggtgcagtgtctggaccggagcggggcggtg
atcgccgccggcctgagcaattacgccagcatcgacatcgaacggatcaagggcaaaaaa
acacgggagatcgaggcaatccttggtggcaaggacagcgacgagatcatccatcgcgac
aacctggtgatcatgggtcgggagggcgggcagtaa

DBGET integrated database retrieval system