KEGG   Desulfobulbus propionicus: Despr_1085Help
Entry
Despr_1085        CDS       T01413                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
dpr  Desulfobulbus propionicus
Pathway
dpr00330  Arginine and proline metabolism
dpr00332  Carbapenem biosynthesis
dpr01100  Metabolic pathways
dpr01130  Biosynthesis of antibiotics
dpr01230  Biosynthesis of amino acids
Module
dpr_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:dpr00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Despr_1085
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Despr_1085
Enzymes [BR:dpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Despr_1085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA DUF2777
Motif
Other DBs
NCBI-ProteinID: ADW17257
JGI: Despr_1085
UniProt: E8RGR9
Position
1214951..1216126
Genome map
AA seq 391 aa AA seqDB search
MTFQVNKDDGLFYRQTLFDQAKRVVIKVGSAVLTDENGLDLNIIGNIARQVSFLQSTGRQ
VILVSSGAVAAGRKRLGVVKTAHEELRVKQALAATGQGLLMQAYEQAFADFNQPVAQVLL
THADLSHRGRYLNVRNTILTLFEFGVVPIINENDTVSAEELRFSDNDTLGALMTNMIGAD
MFIILTDVDSLYTGNPSVDPDARPIYTVASITRDIERMAGQSTSLVGTGGMMAKIRAAKM
VAACGSCSFIGPGRHPDILRALFSGELVGTFFLPGKGKINRRKHWIAYVLKPQGFLVVDD
GARRALVEQGKSLLPSGVTEVRGSFAIGAPVQCLDRSGAVIAAGLSNYASIDIERIKGKK
TREIEAILGGKDSDEIIHRDNLVIMGREGGQ
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgacctttcaggtgaataaggacgacggcctgttttaccgtcaaaccctttttgaccag
gccaaacgggtggtgatcaaggtcggcagcgccgtcctcaccgacgagaatggtctggat
ctcaacatcatcggcaatattgcccgccaggtttccttccttcagtccaccggccgtcag
gtgatcctggtcagctccggggcggtcgccgccggccgcaaacggctcggcgtggtcaag
acggcgcacgaggagctcagggtcaagcaggccttggccgccaccgggcaagggctgttg
atgcaggcctacgagcaggcctttgccgactttaaccagccggtggcccaggtgctgctc
acccatgccgacctgtcccaccggggccgctatctcaatgtccgcaataccatcctcacc
ctgtttgagttcggggtggtgccgatcatcaacgagaacgacacggtttccgccgaagag
ctgcgtttctccgacaacgataccctgggcgccttgatgaccaacatgatcggcgccgac
atgttcatcatcctcaccgatgtcgacagtctctacaccggcaatccctccgtggatccc
gatgcccggccgatctacaccgtggccagcatcacccgcgacatcgaacggatggccggt
cagtccaccagtttggtcggtaccggtggcatgatggccaagatccgcgccgccaagatg
gtggccgcctgcggcagctgctcgttcatcgggccggggcgccatccggacattcttcgc
gcactgttcagcggcgagttggtcggcacctttttcctgcccggcaagggcaagatcaac
cggcgcaagcactggatcgcctacgtgctcaaaccgcagggatttctcgtggtcgacgac
ggtgcccgccgggccctggtggagcagggcaagagcctattgccctccggggtgaccgag
gttcggggcagtttcgccatcggcgcgccggtgcagtgtctggaccggagcggggcggtg
atcgccgccggcctgagcaattacgccagcatcgacatcgaacggatcaagggcaaaaaa
acacgggagatcgaggcaatccttggtggcaaggacagcgacgagatcatccatcgcgac
aacctggtgatcatgggtcgggagggcgggcagtaa

DBGET integrated database retrieval system