KEGG   Desulfobulbus propionicus: Despr_1204Help
Entry
Despr_1204        CDS       T01413                                 

Definition
Malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
dpr  Desulfobulbus propionicus
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dpr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Despr_1204
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Despr_1204
   00630 Glyoxylate and dicarboxylate metabolism
    Despr_1204
Enzymes [BR:dpr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Despr_1204
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1362688..1364601)
Genome map
AA seq 637 aa AA seqDB search
MRTTTLTTHPNVQIRDQLATEYADIYTPEALAALGFMARLGDKQKRLMDERMRRRAARIR
ERRPLAFLDPEALIPGTTIRVGDAREGNFIGAEIPLDLRRQWIQGTGPAAKPNAPIESSL
RNVAYALLSGADGWMFDGEDALGQITAMSLDNQRSLKRALARDPLFLEVAEQVAGEMNTW
ARGFLGREIIADWRTQLDRTTVIFRARGLHLDDRHLRVDGRSFSASIVDLTLYVVNNYRA
LQQRGASLVLYLPKIQTAEEAGFWNHLLSALEGHLGLAEGTIKTYVLVEQLEATFQLMEI
RAALGRHFVGYNTGRWDYINSVCDANCWDPGFVNPNIESILMTYGYMRHYEDRVRRAVNT
PDTNGNCALWQGGMEPNIPVGSQQGVASSMDKARAGAVREQQAGASGKWVAHWKMVHIVR
PVWEAAGEDNQLGRSFPPLGYTEEDAANLTLLEPAPRTVRGARNLLSVALQYGNAFGQGM
QAAALKPADFFGNDDILYLMEDMATGEIRVSILWEWIHKGASLTEDDPETGLKAGDLFSA
EVFLRLLDEEYAKLLAAGHRDVHEKSKTTTLPIARAIVEAYVLDPVKLPWFIDLLNINLN
NTDLGLARQRIADYLAAFKAQGMRITENLDTAPPAGR
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacaacgacactcaccactcacccgaatgtgcagatcagagaccaactggccacc
gagtatgccgacatctacactcccgaggccctggcggcgctcggcttcatggccagactt
ggcgataagcagaaacggttgatggacgaacggatgcggcggcgggcggcccgcattcgg
gagcgacggcccctcgcctttcttgatcccgaagccctgattccaggcaccacgatccgg
gtgggcgacgcccgggaggggaacttcatcggcgcggagatcccgctcgatctgcggcgg
caatggatccagggcaccggcccggccgccaaacccaatgcccccatcgagtcgagcctg
cgcaacgtcgcctatgccctgctctccggggccgacggctggatgttcgacggcgaggat
gccctgggtcagatcaccgccatgtcgctcgacaaccagcgcagtctcaagcgggccctt
gcccgtgacccgctctttctggaggtggccgaacaggtggccggcgagatgaatacctgg
gcgcggggctttctcggccgcgagatcatcgccgactggcggacccagctcgatcgcacc
acggtcatcttccgtgcccgcggcctccatctcgacgaccgtcacctccgggtcgacggc
cgctcattctcggcctccattgtcgacctgactctgtacgtggtcaacaattaccgcgcc
ctgcaacaacgcggcgcttcccttgtcctctacctgcccaagatccagaccgccgaggag
gccggattctggaaccacctcttgagcgcgctcgaagggcatcttggccttgccgagggg
accatcaaaacctacgtgctggtggagcagctggaggccaccttccagctgatggagatc
cgggcggcccttggccgccactttgtcggctacaacaccggccgctgggactacatcaac
agcgtgtgcgacgccaactgctgggacccgggcttcgtcaatcccaacatcgaatcgatc
ctcatgacctacggctacatgcgccactacgaggatcgggtgcggcgggcggtcaacacc
ccggacaccaacggcaactgcgccctgtggcaggggggcatggagcccaacattccggtc
ggctcgcagcagggcgtggccagcagcatggacaaggcccgggccggcgcggtgcgcgaa
cagcaggccggggcgagcggcaagtgggtcgcccattggaagatggtgcacatcgtccgc
ccggtgtgggaagcggcgggcgaagacaaccagctgggccggagcttcccgccgctcggc
tacaccgaggaggacgcggccaacctgaccctgctcgaaccggccccgcgcaccgtgcgc
ggcgcccgcaacctgctcagcgtggccctgcagtacggcaacgcctttggccagggcatg
caggccgcggccctgaaaccggcggactttttcggcaacgacgacatcctgtacctgatg
gaggacatggccaccggcgagatccgggtcagcatcctgtgggagtggatccacaagggc
gcctccctcaccgaggacgatcccgaaacggggctcaaggccggtgatctgttcagtgcc
gaggtcttcctgcgcctgctcgacgaggagtacgccaagctgctcgccgccggtcaccgc
gatgtccacgaaaaatcgaagaccaccaccctgccgatcgcccgggccattgtcgaggcc
tatgtgctcgatccggtcaagctgccctggttcatcgacctgctcaacatcaatctcaac
aacactgacctgggcctggcccggcagcgtatcgccgactaccttgccgccttcaaggcg
cagggcatgcgcatcaccgaaaacctcgacaccgcgccgccggcgggcaggtag

DBGET integrated database retrieval system