KEGG   Desulfobulbus propionicus: Despr_1499Help
Entry
Despr_1499        CDS       T01413                                 

Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
dpr  Desulfobulbus propionicus
Pathway
dpr00010  Glycolysis / Gluconeogenesis
dpr00020  Citrate cycle (TCA cycle)
dpr00620  Pyruvate metabolism
dpr01100  Metabolic pathways
dpr01110  Biosynthesis of secondary metabolites
dpr01120  Microbial metabolism in diverse environments
dpr01130  Biosynthesis of antibiotics
dpr01200  Carbon metabolism
Module
dpr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dpr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Despr_1499
   00020 Citrate cycle (TCA cycle)
    Despr_1499
   00620 Pyruvate metabolism
    Despr_1499
Enzymes [BR:dpr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Despr_1499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ADW17653
JGI: Despr_1499
UniProt: E8RB09
Position
complement(1710661..1711863)
Genome map
AA seq 400 aa AA seqDB search
MGEFRMPSLGADMETGKLVEWLVVPGQRVKRGDIVALVETQKGLFEIEVFEDGIMGEPLV
AAGQTVPVGTLLARIETGEAKAAVTEVRAEPTVEKTTEPSPVSKPQETIPAQPTISSERL
SCSPSARRLALELGVDLATVQGTGPRGAIQRSDIEAAAQAKTITSPQATAAPAESAGDTP
ETRMRQAIAAAVSRSNREIPHYYLATEIDLSHPLQWLEEENRQRSMRERILPVVLLLKAT
AKALRDVPELNGFWLNDRLQVQPDIHVGFAIALRTGGLISPAIHHVDRLSLGELMQAMAD
LIERTRSGRLRGSEVTDATVSVTNLGDRGIKTVFGIIYPPQVALIGFGKISERPWAENGM
LGVRRCVTATLAADHRATDGHQGALFLEALNRHLQQPEAL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaatttcgcatgcccagcctgggcgccgacatggaaaccggtaaactggtcgaa
tggctggtggtgccgggacagcgggtcaaacggggcgatatcgtcgccctggtcgagacc
caaaagggactgttcgagatcgaggtgttcgaggacggcatcatgggtgagccgctggtg
gctgccggccagactgtgccggtgggcaccttgctggcccgaattgagaccggtgaggcc
aaggctgcggtcaccgaggtgcgggccgagcccaccgttgagaagacaaccgaaccttcc
ccagtgagcaagccgcaggaaaccatcccagctcaaccgacgatatcttccgagcggctc
tcctgttcgccctcggccaggcgtctggccctggaactgggggttgatctggccacggtc
cagggaaccggcccgcgcggtgccatccagcgcagcgatatcgaggcagcggcccaggca
aaaacaataacgtccccgcaggcaacggctgcaccagccgaatccgctggggacacgccc
gagaccaggatgcggcaggccattgccgccgcggtcagtcgctccaaccgagaaatcccc
cactattacctggcaaccgagatcgacctgagccaccccttgcaatggctggaggaggaa
aaccgccaacgttccatgcgcgagcgcatcctgccggttgtcctactcctcaaggcaacg
gccaaggccctgcgcgacgtgccggaactgaacggcttttggttgaatgaccgtcttcag
gtgcaaccggacatccatgtcggtttcgccatcgccctgcgcaccggcggcctgatctcg
cccgccattcatcacgtcgaccggctcagcctgggtgaactgatgcaggccatggccgac
ctgatcgagcggacccggtcgggacggttgcgcggttcggaggtcactgacgccaccgtg
tcggtcaccaacctgggtgatcggggcataaaaacggtattcggcatcatctatccgccg
caggtggcgctgatcggtttcggcaagatcagcgagcgaccctgggccgaaaacggcatg
ctgggagtgcggcgctgcgtgaccgccactctggccgccgatcatcgcgccaccgacggc
caccagggtgccctgttcctcgaagccctcaatcgccatctccagcaaccggaggctcta
tga

DBGET integrated database retrieval system