KEGG   Desulfobulbus propionicus: Despr_1610Help
Entry
Despr_1610        CDS       T01413                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dpr  Desulfobulbus propionicus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dpr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Despr_1610
   00052 Galactose metabolism
    Despr_1610
   00500 Starch and sucrose metabolism
    Despr_1610
   00520 Amino sugar and nucleotide sugar metabolism
    Despr_1610
Enzymes [BR:dpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Despr_1610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1849882..1850763
Genome map
AA seq 293 aa AA seqDB search
MKAIRKAVIPVAGLGTRFLPATKAIPKEMLTIVDRPTIQYIVEEAVASGIEEIILVTSAG
KSAIENHFDYDFQLDTVLKDRNKVQLREELNNISNLIDIISVRQKEPLGLGHAIWMARNV
VGDEPFMVLLGDDLVMSKVACCKQMIQLYEQVGESIVAVQRVPMEETHQYGIVEGSPTEQ
ERTYKVDRMVEKPAPGTCNSDMAIIGRYLLMPEIFELLERTTPGHGGEIQLTDALLALSN
KRAMYAYEFVGKRYDAGDKLGYLKAIVDFGLSHNSLGKPFREYLRKVCAELGQ
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgatcagaaaggctgtcatcccggtcgcgggactgggaacacgatttttaccc
gccaccaaggccattcccaaggaaatgctcaccatcgtcgatcggccgaccatccaatac
attgtcgaagaggccgtggcctcgggcatcgaggagatcatcctggtgactagcgccggc
aaatcggccatcgagaaccactttgactatgacttccaactggatacggtgctcaaggac
cgcaacaaggttcagttgcgcgaagagctcaacaacatctccaacctgatcgacatcatc
tcggtacggcagaaggagccgctgggcttgggccatgccatctggatggcgcgcaacgtg
gtcggcgacgaacccttcatggtgttgctcggcgatgacctggtgatgagcaaggtggcc
tgctgcaagcagatgattcagctctacgagcaggtgggcgagtcgattgtcgccgtgcag
cgggtgccgatggaggagacccatcagtatggtattgtcgagggatcgcccaccgagcag
gaacggacctacaaggtcgaccggatggtggagaaaccggcgccgggcacctgcaactcg
gacatggcgatcatcggccgttacctgttgatgccggagattttcgaactgctggagcgg
accacccccggtcacggcggcgagatccagctgaccgacgccctgctggctctgtccaac
aaacgggccatgtatgcctatgaatttgtcggcaaacgctacgatgccggcgacaagctc
ggctacctcaaggctatcgtcgatttcggcctcagccacaacagtttgggcaagccgttc
cgcgagtatctgcgcaaggtgtgcgccgaattggggcagtga

DBGET integrated database retrieval system