KEGG   Desulfobulbus propionicus: Despr_1918Help
Entry
Despr_1918        CDS       T01413                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
dpr  Desulfobulbus propionicus
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:dpr03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2199197..2199808
Genome map
AA seq 203 aa AA seqDB search
MQIIPPALERLIADLTRLPGIGRKTATRLALYILRRPAAEGRNLAHDLMVLHDTIHLCHQ
CFTFSETDPCAICGNPGRDSRLVCVVEEPGDQIAIEKTGVFRGTYHILHGVIAPMDGIGP
DELKIRELRQRVASGQVDEVLIATSSTVPGEATASYLAEMLQDTKVRLSRLACGIPMGMD
IKYADEHTLARAVESRQSVPGRT
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgcagatcattcccccggccctggagcgattgatcgccgacctgacccggttgccggga
atcggccgcaaaacagccactcggctcgccttgtacatcctgcgacggccagcggcggag
ggcagaaatctcgcccacgacctgatggtgctccatgacaccatccacctctgccaccag
tgtttcaccttctccgaaaccgatccctgcgcgatttgcggcaatcccgggcgggattca
cgactagtgtgcgtggtcgaggagccgggcgatcagatcgccatcgagaaaaccggcgtg
ttccgcggcacctaccacatccttcacggggtgatcgcccccatggacggtataggtccc
gacgagctgaaaatacgcgagttgcggcaacgggttgcctccggtcaggtcgacgaggtg
ttgatcgccaccagttccacggtccccggtgaagccaccgcctcctatctcgccgaaatg
ctgcaggataccaaggtccgcctcagtcgtctggcctgtggtattcccatgggcatggac
atcaagtatgccgacgaacacaccttggccagggctgtcgaatcccgccaatcggtgcct
ggacgaacctga

DBGET integrated database retrieval system