KEGG   Desulfobulbus propionicus: Despr_1918Help
Entry
Despr_1918        CDS       T01413                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
dpr  Desulfobulbus propionicus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dpr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Despr_1918
DNA repair and recombination proteins [BR:dpr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Despr_1918
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2199197..2199808
Genome map
AA seq 203 aa AA seqDB search
MQIIPPALERLIADLTRLPGIGRKTATRLALYILRRPAAEGRNLAHDLMVLHDTIHLCHQ
CFTFSETDPCAICGNPGRDSRLVCVVEEPGDQIAIEKTGVFRGTYHILHGVIAPMDGIGP
DELKIRELRQRVASGQVDEVLIATSSTVPGEATASYLAEMLQDTKVRLSRLACGIPMGMD
IKYADEHTLARAVESRQSVPGRT
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgcagatcattcccccggccctggagcgattgatcgccgacctgacccggttgccggga
atcggccgcaaaacagccactcggctcgccttgtacatcctgcgacggccagcggcggag
ggcagaaatctcgcccacgacctgatggtgctccatgacaccatccacctctgccaccag
tgtttcaccttctccgaaaccgatccctgcgcgatttgcggcaatcccgggcgggattca
cgactagtgtgcgtggtcgaggagccgggcgatcagatcgccatcgagaaaaccggcgtg
ttccgcggcacctaccacatccttcacggggtgatcgcccccatggacggtataggtccc
gacgagctgaaaatacgcgagttgcggcaacgggttgcctccggtcaggtcgacgaggtg
ttgatcgccaccagttccacggtccccggtgaagccaccgcctcctatctcgccgaaatg
ctgcaggataccaaggtccgcctcagtcgtctggcctgtggtattcccatgggcatggac
atcaagtatgccgacgaacacaccttggccagggctgtcgaatcccgccaatcggtgcct
ggacgaacctga

DBGET integrated database retrieval system