KEGG   Desulfobulbus propionicus: Despr_1981Help
Entry
Despr_1981        CDS       T01413                                 

Definition
Sec-independent protein translocase subunit TatC
Orthology
K03118  
sec-independent protein translocase protein TatC
Organism
dpr  Desulfobulbus propionicus
Pathway
Protein export
Bacterial secretion system
Module
Twin-arginine translocation (Tat) system
Brite
KEGG Orthology (KO) [BR:dpr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    Despr_1981
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    Despr_1981
Secretion system [BR:dpr02044]
 Twin-arginine translocation (Tat) system
  Twin-arginine translocation (Tat) pathway protein [MD:M00336]
   Despr_1981
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2263645..2264400
Genome map
AA seq 251 aa AA seqDB search
MMFEALEQFRPHQEELRRRLIHCFLALALTSTVAYLCKDQIAAWCMQPLYQAYPQLGKLV
YTKLTEAFLSYLKLSLLVGLIAALPFMLYQCWLFIAPGLLDHEKRTVRAIVLWATLLFAA
GGLFAFFIVLPRMLHYFMSYASPTLQPMLKLGLYLTFAARMILAFGIAFEIPFLMVMAIR
TRLIQKDHFRKKRLYFYIAIVILAFLLTTGELTATILLSFPLFGLYEAGIIAGGVFGGTT
NRPSTEGPSAA
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgatgttcgaggctctggagcagttccgaccgcaccaggaagagctgcgccgccggttg
atccactgttttctggcgttggcgctgaccagcaccgttgcctacctctgcaaggatcag
atcgcggcctggtgcatgcagcccctttatcaggcctatccgcaactgggcaaactggtc
tacaccaaactgaccgaggcctttctcagctacctcaaactctcgctgctggtggggctg
atcgcggctctgccgttcatgctctaccagtgctggctgttcatcgcccccggcctgctt
gaccatgaaaagcgcaccgtccgtgccattgttctctgggcgaccctgctgttcgccgcc
ggcggcctgttcgcctttttcatcgtcctgccccgcatgcttcactacttcatgagctat
gcgtcccccaccctacagccgatgctcaaactcgggctctacctgaccttcgccgcccgc
atgatcctggccttcggcatagccttcgaaatcccctttctcatggtcatggccatccgt
acgcgcctgatccaaaaagatcattttcgcaaaaaacggctctatttttacattgccatc
gtcattctcgcctttctgcttaccaccggtgagctgacagccaccatcctgctctccttc
cccctgttcggcctctacgaggcgggaattatcgccggcggcgtgttcggcggcacgaca
aaccgcccatcgaccgaaggaccttctgcggcctga

DBGET integrated database retrieval system