KEGG   Desulfobulbus propionicus: Despr_1981Help
Entry
Despr_1981        CDS       T01413                                 

Definition
Sec-independent protein translocase subunit TatC
Orthology
K03118  
sec-independent protein translocase protein TatC
Organism
dpr  Desulfobulbus propionicus
Pathway
Protein export
Bacterial secretion system
Module
Twin-arginine translocation (Tat) system
Class
Genetic Information Processing; Folding, sorting and degradation; Protein export [PATH:dpr03060]
Environmental Information Processing; Membrane transport; Bacterial secretion system [PATH:dpr03070]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2263645..2264400
Genome map
AA seq 251 aa AA seqDB search
MMFEALEQFRPHQEELRRRLIHCFLALALTSTVAYLCKDQIAAWCMQPLYQAYPQLGKLV
YTKLTEAFLSYLKLSLLVGLIAALPFMLYQCWLFIAPGLLDHEKRTVRAIVLWATLLFAA
GGLFAFFIVLPRMLHYFMSYASPTLQPMLKLGLYLTFAARMILAFGIAFEIPFLMVMAIR
TRLIQKDHFRKKRLYFYIAIVILAFLLTTGELTATILLSFPLFGLYEAGIIAGGVFGGTT
NRPSTEGPSAA
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgatgttcgaggctctggagcagttccgaccgcaccaggaagagctgcgccgccggttg
atccactgttttctggcgttggcgctgaccagcaccgttgcctacctctgcaaggatcag
atcgcggcctggtgcatgcagcccctttatcaggcctatccgcaactgggcaaactggtc
tacaccaaactgaccgaggcctttctcagctacctcaaactctcgctgctggtggggctg
atcgcggctctgccgttcatgctctaccagtgctggctgttcatcgcccccggcctgctt
gaccatgaaaagcgcaccgtccgtgccattgttctctgggcgaccctgctgttcgccgcc
ggcggcctgttcgcctttttcatcgtcctgccccgcatgcttcactacttcatgagctat
gcgtcccccaccctacagccgatgctcaaactcgggctctacctgaccttcgccgcccgc
atgatcctggccttcggcatagccttcgaaatcccctttctcatggtcatggccatccgt
acgcgcctgatccaaaaagatcattttcgcaaaaaacggctctatttttacattgccatc
gtcattctcgcctttctgcttaccaccggtgagctgacagccaccatcctgctctccttc
cccctgttcggcctctacgaggcgggaattatcgccggcggcgtgttcggcggcacgaca
aaccgcccatcgaccgaaggaccttctgcggcctga

DBGET integrated database retrieval system