KEGG   Desulfobulbus propionicus: Despr_2090Help
Entry
Despr_2090        CDS       T01413                                 

Definition
aldehyde ferredoxin oxidoreductase (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
dpr  Desulfobulbus propionicus
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dpr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Despr_2090
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Despr_2090
Enzymes [BR:dpr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Despr_2090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2390906..2392636
Genome map
AA seq 576 aa AA seqDB search
MADKIFRVNMSDLSTKVEAVPEAWMGLGGRGLTSTIVAAEVNPTCHPLGKNNKLVFAPGL
LSGTPAANSGRLSCGAKSPLTGTIKEANAGGTSAQMLAKLGVKALIIEGKPADDSKWYSL
HVNADGVTIKEETEVIGLGNFAVVQTLNNRLGDKVGVITIGPAGEMKMLGANISIKDPDS
HMRSNGRGGLGAVMGSKKVKFISVEPTDQKVAIADPEAFKAANRTFAKALVDNPISKALA
QYGTNVLVNIINESGGLPTQNFTRGQFEGHEAVSGETMYDTIVARGGKPKHNCHPGCVIQ
CSQIYADAKGQYKTSGFEYETIWALGADCCIDNLDYVAEADNLMDDIGLDSIEIPVAFGV
AMEAGVLKFGDGAELCRILKEEVAKGTPLGRIIGNGAGSVGKAFGVTRVPVVKNQAIPAY
DPRAIKGIGITYATSTQGADHTMGYTIATNILGVGGKVDPLSKEGQVELSRNLQIATAAI
DSTGMCLFIAFAALDDATCLPALIDMINARFGIKLTAADVTNLGMTILKTERAFNLAAGF
TNKDDRLPEFFSEEPIAPHNVVWDITDEAIDSFWNF
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atggctgataaaatttttcgtgtcaatatgtcggacctgagcaccaaggtcgaagccgta
cccgaggcatggatgggcctgggcggtcgcggtctgacctcgaccatcgtcgccgccgaa
gtcaaccccacctgtcacccgctgggcaaaaacaacaagctggtttttgctccgggcctg
ctgtccggtaccccggccgccaactccggccgtctgtcttgtggcgccaaaagcccgttg
accggcaccatcaaggaagccaacgccggcggcacctcggcgcagatgctggccaagctc
ggcgtcaaggccctgatcatcgaaggcaagcccgccgatgactccaaatggtacagcctg
cacgtcaatgcggacggggtgaccatcaaggaagagaccgaagtgatcggcttgggcaac
tttgccgtggtccagaccctcaacaatcgcctgggtgacaaggtcggcgtgatcaccatc
ggtccggccggcgaaatgaagatgctcggcgccaacatttcgatcaaggatccggacagc
cacatgcgctccaacggccgtggcggtctgggcgcggtcatggggtccaagaaggtcaaa
ttcatctctgtcgagcccaccgatcagaaggtggccatcgccgaccccgaagccttcaag
gcggccaaccgcacctttgccaaggccctggtcgacaaccccatcagcaaggccctggcc
cagtacggcaccaacgtcctggtcaacatcatcaacgagtccggcgggctgcccacccag
aatttcacccgtggccagttcgagggccacgaggcggtgtccggcgagaccatgtacgac
accatcgtcgcccgtggcggcaagccgaaacacaactgccatcccggctgcgtcatccag
tgctcccagatctacgccgacgccaagggccagtacaagacctctggtttcgagtacgag
accatctgggccctgggtgccgactgctgcatcgacaacctcgactacgtggccgaggcc
gacaatctgatggacgacatcgggctcgattcgatcgagattccggtggccttcggcgtg
gccatggaggccggagtgctcaaattcggcgacggtgccgagttgtgccgcatcctcaag
gaagaagtggccaagggcacgccgctgggccggatcatcggcaacggcgcgggctcggtg
ggcaaggcctttggcgttacccgcgtgccggtggtcaagaaccaggccatcccagcctat
gacccccgcgccatcaagggcatcggcatcacctacgccacctccacccagggcgcggat
cacaccatgggctacaccatcgccaccaacattcttggcgtgggcggcaaggtcgacccg
ctgagcaaggaaggccaggtggaactgtcgcgcaacctgcagatcgccaccgcggccatc
gactccaccggcatgtgtctgttcatcgccttcgcggcgctcgacgacgccacctgtctg
ccggccctgatcgacatgatcaacgcccgcttcggcatcaagctgaccgcggccgatgtc
accaacctcggcatgaccatcctcaagaccgagcgtgccttcaatctggccgccggcttc
accaacaaggatgaccggctgcccgagttcttctccgaggaaccgatcgcgccgcacaac
gtggtctgggatatcaccgacgaagccatcgactcgttctggaacttctga

DBGET integrated database retrieval system