KEGG   Desulfobulbus propionicus: Despr_2345Help
Entry
Despr_2345        CDS       T01413                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
dpr  Desulfobulbus propionicus
Pathway
dpr00260  Glycine, serine and threonine metabolism
dpr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dpr01100  Metabolic pathways
dpr01110  Biosynthesis of secondary metabolites
dpr01130  Biosynthesis of antibiotics
dpr01230  Biosynthesis of amino acids
Module
dpr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dpr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Despr_2345
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Despr_2345
Enzymes [BR:dpr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Despr_2345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth NMO
Motif
Other DBs
NCBI-ProteinID: ADW18486
JGI: Despr_2345
UniProt: E8RIC5
Position
complement(2694198..2694974)
Genome map
AA seq 258 aa AA seqDB search
MSVDLQQELKKRLQGKPILLMTHLVLGYPSLEINRAVIDQMAANGVDCIELQIPFSEPIA
DGPVILRASQQSLDQGISVEACLRFGQEMALAYPDVKFLFMTYYNIIFKHGEETFLQRTR
DIGFCGTIVPDLPPEEGQSYLAASKRLGLAPIQFFTPTSSDDRMRAVAAQGAGFVYCVAR
RGVTGQQTTFDHGLDQYLARCRRATDLPLAVGFGISNREDVDMLTGKADMAVIGTATIKL
VDSQGPAAVGPFIAGLLR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgtggatttacaacaagaactgaaaaaacgcctgcaaggaaaaccaatcctgctg
atgacccatctggtgctcgggtacccctcgttggagatcaaccgtgcggtcatcgatcag
atggcggcgaacggggtggattgcattgaactgcagatccctttttccgaacccattgcc
gacggcccagtgatcctccgggccagccagcagagcctggatcaggggattagcgtggag
gcctgtttgcgttttggtcaggagatggctttggcctatcccgacgtcaagtttctcttc
atgacctactacaacatcatcttcaagcatggcgaggaaacctttctccagagaacccgg
gatattggtttctgtgggaccattgttcccgatctgccgccggaagaggggcagtcctat
ttggccgccagcaaacgcttgggattggcgcccatccagttttttactcctacttccagt
gatgatcggatgcgagcggtcgcggctcagggcgcaggatttgtctactgcgtggcccgt
cgtggtgtcactggacaacaaaccacttttgaccatggcctcgaccaatacctggctcgt
tgtcgtcgagccaccgaccttcccttggcggtggggtttgggatcagcaaccgtgaagat
gtggacatgctcaccggtaaggccgacatggcggtgatcggcacggcgaccatcaaactg
gttgactcccaaggcccagcggcggtcggaccgtttattgctggattgttgaggtga

DBGET integrated database retrieval system