KEGG   Desulfobulbus propionicus: Despr_2364Help
Entry
Despr_2364        CDS       T01413                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
dpr  Desulfobulbus propionicus
Pathway
dpr00020  Citrate cycle (TCA cycle)
dpr00640  Propanoate metabolism
dpr00660  C5-Branched dibasic acid metabolism
dpr01100  Metabolic pathways
dpr01110  Biosynthesis of secondary metabolites
dpr01120  Microbial metabolism in diverse environments
dpr01130  Biosynthesis of antibiotics
dpr01200  Carbon metabolism
Module
dpr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dpr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dpr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Despr_2364
   00640 Propanoate metabolism
    Despr_2364
   00660 C5-Branched dibasic acid metabolism
    Despr_2364
Enzymes [BR:dpr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Despr_2364
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 ATP-grasp GARS_A Dala_Dala_lig_C
Motif
Other DBs
NCBI-ProteinID: ADW18505
JGI: Despr_2364
UniProt: E8RIE4
Position
complement(2719949..2721106)
Genome map
AA seq 385 aa AA seqDB search
MKIHEYQAKELFRKFNVPTPKGKLALTSDEVEKIAEEFGYPVVVKAQVHAGGRGKGGGVK
LAKTKADVKPVADSIIGMTLVTKQTGAQGKKVRKVLVEEGLNIKKELYLSIIPDRETATV
AIVCSQDGGMDIEEVAAKTPERIITVNVSPITGFQPFHARKICFGLEIEKDLQKQMSALV
KNLYELFMAYDCSMVEINPLIITAEGNILALDAKMDIDGNAMFRHPDVKEMRDIDEEDPV
EAEAAQFGLNYINLDGNVGNIVNGAGLAMATMDIVKLAGASPANFLDVGGGANAEAIENG
FRLIMKDPAVKGILINVFGGILRCDILAKGVVQAATKLKLSVPVVVRMEGTNVEEGRRIL
AESGLDLINAKDLADAAEKVAKIVS
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcatgagtatcaggccaaggaactattccgaaaattcaacgtaccaacccct
aagggaaaactcgccctgacctccgacgaggtggaaaaaatcgctgaagaattcggctat
ccggtcgttgtcaaggcccaggtgcatgccggcggtcgtggcaagggtggtggcgttaag
ctggccaagacaaaagccgacgtgaaacctgtggccgattccatcatcggcatgaccctg
gtcaccaaacagaccggcgcccaaggcaagaaggtgcgcaaggtactggttgaagaaggg
ctgaatatcaagaaagagctctatctctccattattcccgatcgtgaaaccgccaccgtg
gccatcgtttgcagccaggacggcggcatggacatcgaggaagtcgctgccaagaccccc
gagcggatcatcactgtcaatgtcagcccgatcaccggttttcaacccttccatgcccgc
aaaatttgcttcggtcttgagatcgagaaagacctgcagaagcagatgtcagccctggtg
aaaaatctttatgaactgttcatggcatatgactgctccatggtcgagatcaatccgctg
atcatcaccgccgagggcaacatcctcgccctggacgccaagatggacatcgatggcaac
gccatgttccgtcatcccgatgttaaggaaatgcgcgatatcgatgaggaagatccggtc
gaggcagaagcagcccagtttggcctgaactacatcaacctcgacggcaatgtcggtaac
atcgtcaacggcgccggtctggccatggccaccatggacatcgtcaaactggcgggtgcc
tctccggccaacttcctggatgtcggtggcggtgccaatgctgaagctattgagaatggt
ttccgcctgatcatgaaggatccggctgtgaagggtattttgattaacgtcttcggtggt
atcctccgttgcgacattctggccaaaggtgttgtccaggccgccaccaagctgaaactt
tccgtaccggttgttgtccgcatggaaggcaccaacgtggaagaaggtcggagaatcctc
gccgagtccggacttgacctgatcaatgccaaggatctggcagacgcagctgagaaggta
gccaagatcgtttcctga

DBGET integrated database retrieval system