KEGG   Desulfobulbus propionicus: Despr_2376Help
Entry
Despr_2376        CDS       T01413                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dpr  Desulfobulbus propionicus
Pathway
dpr00260  Glycine, serine and threonine metabolism
dpr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dpr01100  Metabolic pathways
dpr01110  Biosynthesis of secondary metabolites
dpr01130  Biosynthesis of antibiotics
dpr01230  Biosynthesis of amino acids
Module
dpr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dpr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Despr_2376
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Despr_2376
Enzymes [BR:dpr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Despr_2376
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADW18517
JGI: Despr_2376
UniProt: E8RIF6
Position
complement(2733252..2734595)
Genome map
AA seq 447 aa AA seqDB search
MKKIVLREDEMPTRWYNVVPDIPNGLLPPLDPETLQPIGPEKLATVFPMSLLEQEMSQER
FIDIPQEVLEVYKIWRPSPLVRATKLEEALGTKAKIFFKNESVSPVGSHKPNSAVAQAYY
NKREGVKRLTTETGAGQWGSALSLATSKFGMECKVYMVRVSYDQKPYRKFIMQAYGGEVV
ASPSMDTKTGREILTSDPDTPGSLGMAISEALEDASSRSDTNYALGSVLNHVVLHQSIVG
LEAKRQMEIAGEFPDVVIGCCGGGSNFAGLVAPFVPDYLEGKKIEFHGYEPASCPSMTGG
KLAYDSGDVAMMTPLLYMYTLGHNFVPPGIHAGGLRYHGMAPIVSALVREGIVIPKAVHQ
LECFEAGILFARTEGIIPAPESNHAIRGAIIEAMKDPNEPKTILFNLSGTGVIDMPSYDN
YLTGKLSDYAYPQEQIEAALARLPKIG
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagattgtgctgcgcgaagacgagatgccgaccagatggtacaatgtggtccct
gacatccccaacggcctgctgcctcccctggaccccgagaccctccagcctatcggcccg
gaaaagctggccaccgtgtttcccatgagccttttggaacaggaaatgagccaggagcgg
ttcatcgacattccgcaggaggttctggaggtctacaagatctggcgcccctcgcccctg
gttcgcgccaccaaactggaggaagccctcggcaccaaggccaagatctttttcaagaac
gaaagcgtcagtccggtgggcagtcacaaacccaattccgccgtggcccaggcctactac
aacaagcgggaaggcgtcaagcgactgaccacggaaaccggcgccggccagtgggggtct
gcgctgtcgctcgccacttccaaattcggcatggagtgcaaggtgtacatggtgcgggtt
tcctatgaccagaaaccctaccgcaaattcatcatgcaggcctacggcggcgaggtggtg
gccagcccgagcatggacaccaaaaccggccgcgagatcctgaccagcgatccggacacc
ccgggctcgctgggcatggccatctccgaagctcttgaggacgcttccagccgcagcgac
accaactacgccttgggctcggtgctcaaccatgtagtgctgcaccagtcgatcgtcggc
ctggaggccaagaggcagatggagatcgctggcgagtttcccgacgtggtcataggctgt
tgtggtggcggctcgaatttcgccggtttggtggcgccgttcgtgcccgattacctcgag
gggaaaaagatcgagttccacgggtacgagccggcctcctgcccgtcgatgaccggcggc
aagctggcctacgactccggcgatgtggccatgatgacgccgttgctctatatgtacact
ctcgggcacaacttcgtgccgccgggtatccatgccggcggcctccgttaccacggcatg
gcgccgatcgtttccgccctggtccgcgaggggatcgtcattcccaaggccgtgcatcag
ctggagtgcttcgaggccggtattctctttgcccgcacggagggcatcatcccggcgccc
gagagcaaccatgccatccgcggggcgatcatcgaggcgatgaaggatcccaacgaaccg
aagaccatccttttcaacctgtccggcaccggcgtgatcgacatgccgtcctacgacaac
tatctgaccggtaaactcagcgattacgcctatccgcaggaacagatcgaggccgctctg
gcccggctgcccaagattggctga

DBGET integrated database retrieval system