KEGG   Desulfobulbus propionicus: Despr_2376Help
Entry
Despr_2376        CDS       T01413                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dpr  Desulfobulbus propionicus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dpr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Despr_2376
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Despr_2376
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Despr_2376
Enzymes [BR:dpr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Despr_2376
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2733252..2734595)
Genome map
AA seq 447 aa AA seqDB search
MKKIVLREDEMPTRWYNVVPDIPNGLLPPLDPETLQPIGPEKLATVFPMSLLEQEMSQER
FIDIPQEVLEVYKIWRPSPLVRATKLEEALGTKAKIFFKNESVSPVGSHKPNSAVAQAYY
NKREGVKRLTTETGAGQWGSALSLATSKFGMECKVYMVRVSYDQKPYRKFIMQAYGGEVV
ASPSMDTKTGREILTSDPDTPGSLGMAISEALEDASSRSDTNYALGSVLNHVVLHQSIVG
LEAKRQMEIAGEFPDVVIGCCGGGSNFAGLVAPFVPDYLEGKKIEFHGYEPASCPSMTGG
KLAYDSGDVAMMTPLLYMYTLGHNFVPPGIHAGGLRYHGMAPIVSALVREGIVIPKAVHQ
LECFEAGILFARTEGIIPAPESNHAIRGAIIEAMKDPNEPKTILFNLSGTGVIDMPSYDN
YLTGKLSDYAYPQEQIEAALARLPKIG
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagattgtgctgcgcgaagacgagatgccgaccagatggtacaatgtggtccct
gacatccccaacggcctgctgcctcccctggaccccgagaccctccagcctatcggcccg
gaaaagctggccaccgtgtttcccatgagccttttggaacaggaaatgagccaggagcgg
ttcatcgacattccgcaggaggttctggaggtctacaagatctggcgcccctcgcccctg
gttcgcgccaccaaactggaggaagccctcggcaccaaggccaagatctttttcaagaac
gaaagcgtcagtccggtgggcagtcacaaacccaattccgccgtggcccaggcctactac
aacaagcgggaaggcgtcaagcgactgaccacggaaaccggcgccggccagtgggggtct
gcgctgtcgctcgccacttccaaattcggcatggagtgcaaggtgtacatggtgcgggtt
tcctatgaccagaaaccctaccgcaaattcatcatgcaggcctacggcggcgaggtggtg
gccagcccgagcatggacaccaaaaccggccgcgagatcctgaccagcgatccggacacc
ccgggctcgctgggcatggccatctccgaagctcttgaggacgcttccagccgcagcgac
accaactacgccttgggctcggtgctcaaccatgtagtgctgcaccagtcgatcgtcggc
ctggaggccaagaggcagatggagatcgctggcgagtttcccgacgtggtcataggctgt
tgtggtggcggctcgaatttcgccggtttggtggcgccgttcgtgcccgattacctcgag
gggaaaaagatcgagttccacgggtacgagccggcctcctgcccgtcgatgaccggcggc
aagctggcctacgactccggcgatgtggccatgatgacgccgttgctctatatgtacact
ctcgggcacaacttcgtgccgccgggtatccatgccggcggcctccgttaccacggcatg
gcgccgatcgtttccgccctggtccgcgaggggatcgtcattcccaaggccgtgcatcag
ctggagtgcttcgaggccggtattctctttgcccgcacggagggcatcatcccggcgccc
gagagcaaccatgccatccgcggggcgatcatcgaggcgatgaaggatcccaacgaaccg
aagaccatccttttcaacctgtccggcaccggcgtgatcgacatgccgtcctacgacaac
tatctgaccggtaaactcagcgattacgcctatccgcaggaacagatcgaggccgctctg
gcccggctgcccaagattggctga

DBGET integrated database retrieval system