KEGG   Desulfobulbus propionicus: Despr_2392Help
Entry
Despr_2392        CDS       T01413                                 

Definition
ACP S-malonyltransferase (EC:2.3.1.39)
Orthology
K00645  
[acyl-carrier-protein] S-malonyltransferase [EC:2.3.1.39]
Organism
dpr  Desulfobulbus propionicus
Pathway
Fatty acid biosynthesis
Metabolic pathways
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:dpr01212]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:dpr00061]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2748836..2749783)
Genome map
AA seq 315 aa AA seqDB search
MKKTAIIFPGQGSQFIGMGQEFVNRDQDASVLMDLAETISAFPLRKLCFEGPLEDLTRVL
YLQPALTVINLICWQQLLKLLPGFKPAFFAGHSLGEYSALHGAGVLTLEDTLALVTKRGE
LMEREGAAHPGGMRAVVGLAINDVEALLERFTGPGVAVVANHNTASQIVLSGDAPGLEAI
GQLCAAQGAKVIPLKVSVANHSPLVAGAVEDFAAYMNSIEFQHPQVPVLFNVTGDYEQNP
SAMRNIMARQIASRVRWLSIIERMVAEGVEVVVELGPKNVLTGMMKKILPKDTPITCLQA
DSPEGLHKVAEVLAG
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacagcgattatttttccgggacaggggtcccagtttatcggcatgggccag
gaattcgtcaatcgggaccaagatgcctcggtcttgatggatctggccgagaccatctct
gcctttccgttgcgcaaactctgctttgaaggcccgttggaggatctgactcgtgtcctc
tatctgcagccggccttgacggtcatcaatttgatttgttggcagcaactgctcaaactc
ctgcccggattcaagcccgccttttttgccggtcacagccttggcgagtattcagccctg
catggggcgggtgttttgaccctggaggacaccctagccctggtgaccaagcgcggggaa
ctgatggaacgggaaggcgcggcccatccgggcggcatgcgggcagtggtcggtttggcc
atcaatgacgtggaagcgctcctcgaacgcttcactggtccgggcgtggcggtggtggcc
aaccacaacacggcttcccagatcgtcctgtcgggcgatgctcccggcttggaagccatc
ggccaactctgtgcggcccagggcgccaaggtgattccccttaaggtaagcgtggctaac
cacagtcctctggtggcgggcgcggtggaggatttcgccgcctacatgaacagcattgag
ttccagcacccccaagtgccggtcctgttcaatgttaccggcgactatgagcagaatccc
tcggcgatgcggaacatcatggcccggcagatcgcctcgcgggtgcggtggctgtccatt
atcgagcggatggtggccgaaggagtggaggttgtggtcgaattggggccgaagaacgtc
ctcactggaatgatgaaaaaaattctgccgaaggacacgccgattacctgcctgcaggca
gacagtccggagggactccacaaggtcgccgaggtgctggccgggtga

DBGET integrated database retrieval system