KEGG   Desulfobulbus propionicus: Despr_2484Help
Entry
Despr_2484        CDS       T01413                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritolkinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
dpr  Desulfobulbus propionicus
Pathway
dpr00900  Terpenoid backbone biosynthesis
dpr01100  Metabolic pathways
dpr01110  Biosynthesis of secondary metabolites
dpr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dpr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Despr_2484
Enzymes [BR:dpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Despr_2484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ADW18622
JGI: Despr_2484
UniProt: E8RJH9
Position
complement(2835956..2836861)
Genome map
AA seq 301 aa AA seqDB search
MQREQLLLRAPAKVNLYLKVIGRRADGYHLLDTLMQKVGLYDEIEVQACAEGIHLHCVNG
TLPENRDNIVYRAAELFLRETQGRRKGDANGVRVSLTKRIPVAAGLGGGSSDAAATLNGL
NELYQCGCSGAELAAMGLRLGADVPFFLATAPAAIATGIGEQLHPVPPLKGCSLVLVNPG
IPVSTRWVYQNFALTVDKIGSNLKNSQEDIDRSFTPREPLLPESWAARSCNDLERVTLAR
HPQIEQIKAGLVESGAVGALMSGSGPTVFGVFSNRQQAEVGFIRFKSRFVYTYLVDPVEE
E
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgggagcaactccttctccgggcgccggcaaaggtcaatctttatctcaaagtg
atcgggcggcgagccgacggctatcatttgctggacacgttgatgcagaaggtcggcctt
tatgacgaaatagaagtgcaggcctgcgccgagggcatccatctgcactgtgttaacggc
acccttccggaaaacagggacaatatcgtttaccgagcggcggaactgtttttgcgggaa
acccaagggcgacgaaaaggggatgccaatggggtgcgcgtgtcgctgaccaagaggatt
ccggtggcggcgggcctgggtggtggcagcagcgatgcggcggcgaccctcaatggattg
aatgaactgtatcaatgcggttgttccggcgcggagttggccgccatggggctccgcctg
ggtgcggatgtgcccttttttcttgccactgccccggcggcaatcgccaccggtattggg
gagcagctgcatcccgtcccgccgctgaagggatgtagccttgttctggtcaatcccggt
attccggtttcgacccgctgggtgtatcagaattttgcgttgacagtggataaaattggg
agtaacctaaaaaattcgcaggaagatattgatcggtccttcacccctcgcgagcccctt
ctgccggaatcatgggcagcgcgatcgtgcaacgatctcgaacgggtcacgctcgcccga
cacccgcaaatcgaacagatcaaggcggggttggtcgaaagcggggcggtcggagcgttg
atgtctggatcagggccgacggtctttggtgtattcagtaatcggcagcaggcggaagtc
ggcttcattcgtttcaagagccggtttgtgtacacctacctggtagatcctgttgaggaa
gaatga

DBGET integrated database retrieval system