KEGG   Desulfobulbus propionicus: Despr_2594Help
Entry
Despr_2594        CDS       T01413                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dpr  Desulfobulbus propionicus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:dpr01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:dpr01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dpr00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:dpr00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:dpr00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:dpr00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:dpr00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2976196..2977284)
Genome map
AA seq 362 aa AA seqDB search
MREKLLISTGGGDAPGLNAVIFAVVNSATRKGWEVYGSRYGYGGLLDRDDLVRLTPEDVE
GILSQGGTILGSTNKGNPFCKPVENLAGETQIVDISDKILNAFNRMGFFCHIAVGGDGSL
EIAHRFALKGMPVIGVPKTIDNDLEATDRTFGFDTAVSTATDAIDKLHSTAKSHDRVMVV
EVMGRDSGWIALYSGISGGADVILIPEIPFKLDAVCAKIADNELHGKHYSIVVVAEGARA
EDGEVISKGQGEVGRSEVVLGGIGEWVANQIRQRLGKDTRSLVLGHLQRGGSPTTFDRLL
ALRFGAAAVRMAEAGIFDHMVAWVPPTMTSVPIAEAIRRRKKVDLESDKVRTARDIGICL
GD
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgaaaagctactcatatccaccggcggcggcgatgccccgggactgaatgccgtt
atttttgccgtggtcaattccgccaccagaaaggggtgggaggtctacggcagccgatac
gggtacggtggcctgctggatcgagacgacctggtccgcctgaccccagaggacgtcgag
ggcattctttcccagggtgggaccattcttggttccaccaacaagggcaatcccttttgc
aagccggtggaaaatttggctggagagacgcagatcgtcgatatttctgataaaattctc
aatgcgttcaatcggatgggctttttttgccatattgccgtgggcggcgacggcagtttg
gagattgctcaccgttttgccctcaaaggcatgccggtgatcggcgtgcccaagaccatc
gacaatgacctggaggccacggaccggacctttggctttgacaccgccgtgtccaccgcc
accgacgccatcgacaaactgcattccacggccaagtcccacgaccgggtgatggtggtc
gaggtcatgggccgcgattctggctggattgccttgtactccgggatctccggcggcgcc
gatgtgatcctcattccggagattcctttcaagctcgatgcggtctgcgccaagattgcc
gacaacgagttgcacggcaagcactattcgatcgtggtggtggccgagggcgcgcgggcc
gaggatggcgaggtgatcagtaaagggcagggcgaagtcgggcgatccgaggtggtgctc
ggcggtatcggcgaatgggtggccaaccagatccgccagcgtctgggcaaggatacccgg
tccctggtgttggggcatctgcaacgcggcggttcgcccaccacctttgaccggctgctg
gccctgcgcttcggtgcggcggcggtgcgcatggccgaggccggcatcttcgaccacatg
gtggcctgggtaccgccgaccatgacctccgtacccatcgccgaggcgattcggcggcga
aaaaaggtggacctggaaagcgacaaggtacggaccgcccgcgacatcggcatctgtctg
ggtgactga

DBGET integrated database retrieval system