KEGG   Desulfobulbus propionicus: Despr_2740Help
Entry
Despr_2740        CDS       T01413                                 

Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
dpr  Desulfobulbus propionicus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dpr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Despr_2740
Enzymes [BR:dpr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Despr_2740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3154032..3155894)
Genome map
AA seq 620 aa AA seqDB search
MNPAHLLDFLLAGHWLRPIDVQAAQLLERIDQGCCPQLLLAAAFASWATGQGHTCLPLSV
LPELLAAAGVDNAAYRDSGQLRVQLLRSTVVGAPGDLRPLILDADNHLFLHRLYRDETVI
ARALSRRAAGIEAVDQRAALPLVEALFPESKGAVEVDWQRAAAVLALHKRLVIISGGPGT
GKTYTVARMLALLIALTPTKPRIALAAPTGKAALRLRESIRRAKDALPPLLATPIPEQAQ
TLHRLLGVHHDRPGFRHHGANPLHLDLLILDEASMIDVPLMAALLAALPAACRVILLGDR
DQLASVEAGNLFGDLCGEGAAGWSARLIRHMRGLLGPRQMPASVPLASSLGDCLVLLHTS
RRFHEGSGIGTLARAVNSGAPEAVAAILDAAPPDLHIEETHGAAQTPWLRDQIAQCFLPL
FAADTPLNALRALGQRRILCALREGPGGVEGINRLAETIFRRLGRIATMERFYRGMPILI
QRNDYGLGLFNGDTGILWPDDQGRLQAWFAEENGEVRPVSLARLPSWQVSYAITVHKAQG
SEFDEVLLLLPQEDAPVLSRELLYTGITRARRRFSLFGPRALLLRAVRRRLVRYSGLAGI
VARIGGHPPGEEATRAGAGD
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgaacccagcgcatctccttgacttcctgctcgccggccattggttgcggcccattgat
gtccaggcggcccagttgttggaacggatcgatcagggttgctgcccgcaactactcctg
gccgccgcctttgccagctgggcaaccggacagggccacacctgtctgcccctgtccgtc
ctgccggagcttctggcggcggcaggcgtggacaacgccgcctatcgggacagcggacag
ctgcgcgtgcagttgctgcgctccaccgtggttggcgcgcccggcgatcttcggcccctg
attctggatgcggacaatcatctctttcttcaccgtttgtaccgggacgagacggtcatc
gcccgcgccctgagccggcgggccgccggcatcgaggccgtggaccagagggcggccctg
cccctggtcgaggccctctttcccgaaagcaagggggcggtcgaggtggactggcagcgg
gcagcggcggttctggcgctccataaacggctggtgatcatttccgggggaccgggaacc
ggcaagacctacaccgtggcccggatgctcgccctgctgattgccctgacgccaaccaag
ccgcgtatcgccctggccgctcccaccggcaaggcggcgctcaggctcagggaatccatt
cgccgcgccaaggacgccttgccccccttgctggcgacgccgattcccgaacaggcccag
accctgcaccggctgctcggcgtgcatcacgaccgtcccggtttccgccaccatggggcc
aatccgctccaccttgatctgttgatcctggatgaggcctcgatgatcgacgtgccgctg
atggccgccctgctcgccgccctgccggccgcctgccgggtgattctcctcggcgaccgt
gatcagctggcctcggtggaggcgggtaacctgtttggcgatttgtgcggggaaggggct
gcgggctggtcggcaaggctgattcggcacatgcgggggctgctcggaccgaggcagatg
cctgcctccgtccccttggcctcgtccctgggcgattgcctggtgttgctgcacaccagc
cgtcgctttcatgaaggctccggcatcggtaccctggcgcgggcagtcaacagcggcgcg
cccgaggccgtggccgcgattctggatgccgccccgccggatctccacatcgaggaaacc
catggggcggcccagaccccctggctgcgcgaccagatcgcgcaatgcttcctgccgctg
tttgccgccgacacaccgctgaacgccttgcgggcgcttggacaacgccgcatcctctgt
gccctgcgcgaggggccgggcggggtggaaggcatcaaccggctggcggagacgatcttt
cgccgcctggggcgtatcgcaacgatggaacggttctatcgcggcatgccgatcctcatc
cagcgcaacgattatgggttagggctgttcaacggcgacaccggcatcctctggcccgac
gaccagggcaggttgcaggcctggttcgccgaggaaaacggcgaggtccggccggtcagc
ctggcccgtctgccaagttggcaggtttcctacgccatcaccgtgcacaaggcgcaggga
tcggagttcgacgaggtgctgctgctccttccccaggaggatgcaccggtcctcagccgg
gaactgctgtacaccggcatcacccgagcgcggcgacggttctccctgtttggcccgcgc
gccttgctgctgcgcgcggtccggcggcggctggtgcgctattccggtctggcggggatc
gtggcccgcatcggagggcacccaccgggcgaggaggcgacacgagccggagcaggcgac
tga

DBGET integrated database retrieval system