KEGG   Desulfobulbus propionicus: Despr_2789Help
Entry
Despr_2789        CDS       T01413                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
dpr  Desulfobulbus propionicus
Pathway
dpr00230  Purine metabolism
dpr01100  Metabolic pathways
Module
dpr_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:dpr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Despr_2789
Enzymes [BR:dpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Despr_2789
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_16 AAA_22 AAA Rad17 NTPase_1 AAA_18 RsgA_GTPase MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: ADW18923
JGI: Despr_2789
UniProt: E8RCH7
Position
complement(3220840..3221448)
Genome map
AA seq 202 aa AA seqDB search
MHDCLLLVLSAPSGCGKTTIVNRVMRELPGLVFSVSHTTRPPRPGEHEGIHYHFVDQNTF
AAIRNQQPTGFLEWAEVHGNLYGTSVAEVERHQRAGLDVLLDIDVQGAAQVCQRTNPVTV
FIAPPTLADLEQRLRGRGTEDEATLAVRLNNARKELACVNAYDYLIVNDRLDEAVESLRS
IIIAERCRRRRTSSGQPMSWST
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgcatgactgcctgttacttgtgctttccgccccttccggctgcggcaagaccaccatc
gtcaaccgggtgatgcgggagctgcctggactggtcttctccgtctcccacaccactcgt
cccccccgccctggcgaacacgagggcatacactatcatttcgtcgaccagaataccttc
gccgccattcgcaaccagcaacccacaggctttcttgaatgggcggaggtccatggcaac
ctttacggtaccagtgtagccgaggtggagcgacatcagcgggcagggttggatgtgctc
ttggatattgacgttcagggggcggcgcaggtgtgccaaagaaccaatcccgtgacggtg
ttcattgctccgccgacccttgccgatttggagcagcgattgcgaggacggggcacggaa
gacgaggcgacgctggctgttcgcctgaacaatgcccgcaaggaattggcctgtgtcaac
gcctatgactatctgattgtcaatgaccggcttgacgaggcggtggagagcctgcgcagc
atcatcatcgccgagcgctgtcggcggcggcggacctcctctgggcaaccgatgtcgtgg
tcaacctga

DBGET integrated database retrieval system