KEGG   Desulfobulbus propionicus: Despr_3108Help
Entry
Despr_3108        CDS       T01413                                 

Definition
(GenBank) protoporphyrin IX magnesium-chelatase
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
dpr  Desulfobulbus propionicus
Pathway
dpr00860  Porphyrin and chlorophyll metabolism
dpr01100  Metabolic pathways
dpr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dpr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Despr_3108
Enzymes [BR:dpr01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Despr_3108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 AAA_16 MCM AAA_3 Sigma54_activat AAA
Motif
Other DBs
NCBI-ProteinID: ADW19241
JGI: Despr_3108
UniProt: E8RFD4
Position
complement(3575638..3576678)
Genome map
AA seq 346 aa AA seqDB search
MNNRPIYPFTAIVGQEKMKLALMLNVVNPGLSGVLIRGEKGTAKSTAVRALADILPEIAV
FSEDPFQLDPESELDVFTEIRLLTQGHPPEACPEVSKRKVRVVELPVGATEDRVVGTLDL
EHALKKGEKRIEPGILAQAHRNILYVDEVNLLDDHVVDVLLDSAAMGVNTIEREGVSFSH
PARFTLVGTMNPEEGELRPQLLDRFGLCVNIEGIHRAEDRVTIMERRAAFDLDPEGFAAR
WIAESEALADRLLIARALYPQVEVQRPLLFEIAQTCLEVGVDGHRGDIIMLKTAKTLAAL
DGRTKVESADISASAELVLPHRVRRQPLMEIADNVQALRKRALAGQ
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaccgacccatctatcccttcaccgccattgttggtcaggaaaaaatgaaactg
gccctgatgctcaatgtggtcaatccaggtctctccggggtgctcatccgcggtgagaag
ggcacggccaagtcgacggcggtccgtgccctggctgacatcctccccgagattgcagtg
ttcagcgaggatccgttccaactcgaccccgagtcggagttggatgtgtttaccgagatc
cgtctgctcacccaaggccatcctcccgaggcctgccctgaggtgagcaagcgcaaggtg
cgggtggtggagctgcctgtgggcgccaccgaggaccgggtggtgggcacccttgatctc
gaacatgccctgaaaaaaggggaaaaacggatcgagcccggcatcctcgcccaggcacac
cgcaacatcctctatgtcgatgaggtcaacttgctcgatgaccatgtggtggatgtgctg
ctcgattccgctgccatgggcgtcaacaccatcgagcgtgagggggtctccttttcccat
ccggcccgtttcaccctggtggggaccatgaacccggaagaaggagagctgcggccgcag
ttgctcgaccgcttcggtctctgcgttaacattgaggggattcaccgggcggaagaccgg
gtgacgatcatggagcggcgggctgcctttgatctcgatccggagggctttgccgcccgc
tggatcgccgagtccgaggccctggccgaccgcttgctcatcgcccgcgccctctacccg
caggttgaggtgcagcggccgctgctgttcgaaatcgcgcaaacctgcctggaagttggg
gtggacgggcatcgcggcgacatcatcatgctcaagaccgccaagaccctggcggccctg
gacggccgtaccaaggtcgaatcggcagacatcagcgccagcgccgaactggtcctgccg
caccgggtacggcggcaaccgctgatggagatcgccgataatgtccaggccctgcgtaaa
cgggcactggccgggcagtga

DBGET integrated database retrieval system