KEGG   Desulfobulbus propionicus: Despr_3109Help
Entry
Despr_3109        CDS       T01413                                 

Definition
protoporphyrin IX magnesium-chelatase (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
dpr  Desulfobulbus propionicus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dpr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Despr_3109
Enzymes [BR:dpr01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Despr_3109
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3576675..3578720)
Genome map
AA seq 681 aa AA seqDB search
MGNCMRKAIYPLAAVVGQDSFKQALLLAAINPGVGGLLVRGEKGTAKSTMVRALAALLPE
MEVVAGCVNSCSPAPSSPRCPECERRFPDLPRATRPVPLVDLPLNATEDRVSGGIDFPRT
LREGRVVVSPGLLAEAHRGLLYIDEVNLLDDHIVDLILDASASGENRIEREGISYRHPSR
FILVGTMNPEEGELRPQLLDRFGLCLEVTGAEEPELRVELMERREAFDQDPAGFVRRYRE
ENEQLAHRIIQGQTLLPWVRLSKGLRGFIAALCQENNVAGHRADLVLEQAARALAALEGK
TEVSVEHIGKVAPLVLLHRRRDAQPPPPPPPPEPPLPEETDQQEQEEQSEQQEQQQPQEN
PQSQTAPPPPQPQEQSQEESQSEEQAEEEIQGQAAAEREDQVFAIGSTFQVKPLAAAKDR
VVRRGSGRRTRSRISQKQGRYVKSTLHNNGDFALDATLRAAAPYQQQRAGKNGSDLAVQL
RPQDIRSKVREKRIGNFLLFVVDASGSMGARGRMAASKGAVMSLLLDAYQKRDKVSMITF
RRDAAFINLPPTTSVDMAGRLLAEMPVGGRTPLSAGLAKSFEQVRNYLIKNPTAQPIVLF
ITDGKCNVSLGEQKPVEESLRLAEALGRDQRIRSIVVDTEEAGLVTFGLARRLAGAMEAQ
YFKIDDLKAEALVNIVRGQHP
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atggggaattgcatgagaaaagcgatctatcccctggcggcggtggtcggccaggacagc
ttcaagcaggcgctgctgctggcggccatcaatcccggcgttggcggcctgctggtgcgc
ggcgaaaagggcacggccaagtcgaccatggtgcgggccctggcagccttgctaccggag
atggaggtggtggcgggttgcgtcaacagctgttcgcccgcgccctcaagcccacgttgc
ccggaatgcgagcggcgctttccggatctgccccgtgccacccggccggtacccttggtg
gatctgccgctcaatgccaccgaagatcgggtcagcggtggcattgatttcccccgtacc
ctgcgcgaggggcgggtggtggtctcccctggcctgctcgccgaggcccaccgcggcctg
ctctacatcgacgaggtcaacttgcttgatgatcacatcgtcgatctgattctcgatgcc
tcggccagcggggagaaccgtatcgagcgcgagggcatctcctaccgccatccgtcgcgc
tttatcctcgtgggcaccatgaatccggaagaaggcgagttgcggccgcaactgctcgac
cgcttcggcctctgtctggaggtgaccggggccgaggagcctgagttgcgggtcgaactg
atggagcggcgcgaggcctttgatcaggatccggccggctttgttcgccgctaccgcgag
gagaacgagcaactggcgcaccgtatcatccagggacagaccctgctgccctgggtgcga
ctcagcaagggactgcgcggcttcatcgctgctctctgccaagaaaataatgttgccggt
caccgggccgacctggtgctggagcaggcggcgcgagccctggccgccctggagggcaag
accgaggtcagtgtggaacatatcggcaaggtggcgccgttggtgctgctgcaccgccgc
cgggatgcccagcccccaccccctccgcccccaccggaaccccctttgcccgaggaaacc
gaccaacaggagcaggaagaacagagcgagcagcaggaacagcaacaaccccaggagaat
cctcaaagccagacggcaccgcctccaccccaaccgcaggagcagagccaggaggaatcg
caatccgaggaacaggccgaggaggaaatacagggccaggcagccgcagaacgcgaggac
caggtctttgccatcggctccacctttcaagtcaaaccgcttgctgccgccaaggaccgg
gtggtgcgccggggctcgggccgacgcacgcgcagccgtatctcgcagaagcaggggcga
tacgtcaagagcaccctgcacaataacggcgactttgccctcgatgccaccctgcgcgcc
gctgccccgtatcagcagcagcgggcagggaaaaacggcagcgacttggcggtgcagctc
aggccccaggatatccgctccaaggtgcgcgagaaacgtatcggcaactttctcctcttc
gtggtcgatgccagcggttccatgggggcgcgggggcggatggccgcctctaagggtgcg
gtgatgtcgctgctgcttgatgcctaccagaagcgcgacaaggtctcgatgatcaccttc
cgccgcgatgcggccttcatcaacctgccgcccaccacctcggtggatatggccggccgg
ctgcttgccgagatgccggtgggtgggcgcaccccgctttccgccggactggccaagagt
tttgagcaggtgcgcaactacctgatcaagaaccccaccgcccaacccattgtgctcttt
atcaccgacggcaagtgcaacgtctccctgggggagcagaagccggtggaggagtcactg
cgcctggctgaggccctgggccgtgaccagcgcatccgctccatcgtcgtcgataccgag
gaggccggtctggtcaccttcggtttggcccggcggctggccggggccatggaggcccaa
tactttaaaatcgatgacctcaaggctgaagccttggtcaacatcgtgcgaggacaacac
ccatga

DBGET integrated database retrieval system