KEGG   Desulfobulbus propionicus: Despr_3149Help
Entry
Despr_3149        CDS       T01413                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dpr  Desulfobulbus propionicus
Pathway
dpr00010  Glycolysis / Gluconeogenesis
dpr00051  Fructose and mannose metabolism
dpr01100  Metabolic pathways
dpr01110  Biosynthesis of secondary metabolites
dpr01120  Microbial metabolism in diverse environments
dpr01130  Biosynthesis of antibiotics
dpr01200  Carbon metabolism
dpr01230  Biosynthesis of amino acids
Module
dpr_M00002  Glycolysis, core module involving three-carbon compounds
dpr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dpr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Despr_3149
   00051 Fructose and mannose metabolism
    Despr_3149
   00562 Inositol phosphate metabolism
    Despr_3149
Enzymes [BR:dpr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Despr_3149
Exosome [BR:dpr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Despr_3149
  Exosomal proteins of bladder cancer cells
   Despr_3149
  Exosomal proteins of melanoma cells
   Despr_3149
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM DUF1538
Motif
Other DBs
NCBI-ProteinID: ADW19277
JGI: Despr_3149
UniProt: E8RFV2
Position
complement(3623488..3624243)
Genome map
AA seq 251 aa AA seqDB search
MERRPFIAGNWKMHLTLAEAVQLAQAVAPTCAACPDRDIMIAPSFTSLAAVCAAVKGSGL
QVGAQNIAWDREGAYTGEISSPMLKDLGVSLAIIGHSERRHIFGEDNAMINRRLHGALDG
DIRPILCIGETLADREAGKTFAVLDTQVREGLQAVNSAQMECVVLAYEPVWAIGTGKTAS
KEQAQEVHAFLRQLLAAMYEKTVAETVRILYGGSVKPDNIDDLMAQPDIDGALVGGAALK
AESFDRIARFR
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggagaggcgtccttttatcgcaggcaattggaagatgcatctgaccctcgccgaggcg
gtgcaattggctcaggccgtggcacctacctgcgccgcctgcccggaccgcgacatcatg
attgccccgtccttcacctcgttggccgcggtctgcgcggcggtcaagggctccggcctg
caagttggggcgcaaaatattgcctgggacagggagggcgcctataccggtgaaatttct
tcgcccatgctcaaggatctgggggtgagcctggcgattatcggtcattccgagcgacga
catatcttcggcgaggataacgccatgatcaatcgtcgcctgcacggcgccctcgatggc
gatattcgaccgatcctgtgcattggcgaaacactggcggatcgtgaggccggcaagacc
tttgccgtgctcgacacccaggtgcgcgaagggttgcaggccgtgaacagtgcgcagatg
gagtgcgtggtgcttgcctacgagccggtctgggccattggtaccggcaagacggccagc
aaggagcaggcgcaggaggtgcatgcttttctccgtcaattactggcggccatgtacgag
aaaactgttgccgaaacggtgaggatactgtatggtggctcggttaaacctgataatatt
gatgacctgatggcgcagccggatatcgatggcgcgcttgttggtggcgccgccttgaag
gccgaatcgtttgaccggattgcccgatttcgatga

DBGET integrated database retrieval system