KEGG   Desulfobulbus propionicus: Despr_3340Help
Entry
Despr_3340        CDS       T01413                                 

Definition
Deoxyribodipyrimidine photo-lyase type II (EC:4.1.99.3)
Orthology
K01669  
deoxyribodipyrimidine photo-lyase [EC:4.1.99.3]
Organism
dpr  Desulfobulbus propionicus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3835279..3836634)
Genome map
AA seq 451 aa AA seqDB search
MHGGAVHTSGPVLYWMHRAFRSRDNWALLHAAQQARYLGVPLAVAFCLAPTFLDATLRQY
DFFLNGLEETARSLAEANIPLILRSGDPAEEMVRLCTELTPALVATDFDPLRVKRQWLRT
VTGHVRCPVHEVDSRNIVPAWIASDRREFMAKTFRPRIHRHLQDFLTVVPPLQPHPHAWP
TLPGSLDFPALRARLRVDRSVQPVSWPRSGEAAAWDTLDTFLRERLAGYGQRNDPNQSVC
SNLSPFLHFGMISSHAIVLEIGRRGLHGEVVDSFIEELVVRRELADNFCLHTPDYDQISG
FPEWAQRTLARHRHDPRPYVYDDAQFDRAQTHDPLWNAAQHQLVASGKMAGYMRMYWAKK
ILEWSEDPAEALRIAIWLNDRYALDGRETNGYSGIAWSIGGVHDRGWTERPIFGTIRSMS
EAGCRRKFDVNRYIHTWTPGQPSLFPASRTL
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgcacggcggggccgtccacacttcaggccccgtgctttactggatgcaccgtgcattc
cggagccgggacaactgggccctgctccacgccgcccaacaggcccggtacctgggggtg
ccgttggcggtggcgttctgtctggcgccgacctttctcgatgccaccctgcggcagtac
gattttttcctcaatggcttggaagagactgcccgcagcctggccgaggccaacatcccc
ctgatcctgcgcagtggtgacccggcagaagaaatggtccgcctgtgcaccgagttgacc
ccagccctggttgccaccgatttcgatccgctgcgggtcaagcggcagtggctgcgcacc
gtgaccggccacgtccgctgcccggtgcacgaggtcgattcccgcaacatcgtgcccgcc
tggattgcctcggaccgccgggaattcatggccaagacctttcggccgcgcattcatcgc
catctccaggattttctcaccgtcgtgccgccgttgcaaccgcatccgcatgcctggcca
accctgccgggcagcctcgatttcccggccctgcgcgcacgcctgcgggtggaccgcagt
gtccagccggtgtcctggccacgatccggtgaagccgccgcctgggacaccctggacacc
ttcctccgcgaacggctggcgggctacggacagcgcaacgacccgaaccaatcggtctgc
tccaatctttctccttttctccatttcggcatgatctcgtcccacgcgatcgtcctggaa
atagggcggcgcggcctccacggcgaggtcgtggacagctttatcgaagaactggtggtg
cggcgcgagctcgcggacaacttctgtctgcacacgccggattatgaccagatcagcggc
tttcccgaatgggcgcagcggacgcttgcccggcaccgccatgacccgcggccgtacgtg
tatgacgatgcgcagttcgaccgcgcccagacccacgatcccctgtggaacgcggcccag
caccagctggtggccagcggcaagatggccggatacatgcgcatgtactgggcaaaaaag
atcctcgaatggagcgaagacccggcggaggccctgcgcatcgccatctggctcaacgac
cgctatgcccttgatggccgggaaaccaacggctacagcggcattgcctggtcgatcggc
ggagtccatgaccggggctggaccgagcggccgatcttcggcaccatccgctccatgagc
gaggccggctgccgccgcaaattcgatgtcaaccgctatatccacacctggacaccggga
cagccatccctgttcccggcatcccgcaccctgtaa

DBGET integrated database retrieval system