KEGG   Desulfotalea psychrophila: DP0022Help
Entry
DP0022            CDS       T00192                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dps  Desulfotalea psychrophila
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:dps00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:dps00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:dps00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:dps00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(21049..21915)
Genome map
AA seq 288 aa AA seqDB search
MRVKKAIFPVAGLGTRFLPATKAMPKEMLPVVDKPLIQYAVEEALASGIEQLIFVTGSGK
SALENHFDSSYQLEDTLRKRGKDELLRTVESLVPASGSIIYTRQSQPLGLGHAIWCARDV
VGDEPFAVLLADDLIKSEKPVLQQMIHQFDRLRASMVATIEVPREETNRYGILEGETVYD
GILQISSMVEKPKPEDAPSNLAAIGRYIFTPRIFDFLGKQQTGAGGEIQVTDAMVALLAE
QPIFGVGFEGTRFDCGDKVGFQKANIAFALEHPEIGGPLREYLQGLEL
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgagagtaaaaaaggctatttttcccgtagcaggtttaggaacgcgttttctccctgcc
accaaggcgatgcctaaggagatgcttcccgtggtggacaagccgcttatccagtatgcg
gtggaggaggccctggcctctggtatagagcaactgatctttgtcacgggcagtggtaag
tcggccctggaaaatcattttgacagtagttatcagctggaggataccctgcgtaaacgt
ggtaaggatgagctgctgcgtacggtggagtctctggtccccgcctccgggtctattatt
tacactcgccagagtcagccattagggcttggtcatgccatctggtgtgcccgtgatgtg
gtgggggatgaaccctttgccgtccttttggccgatgatcttattaagagtgaaaagcct
gtcttgcagcagatgatccaccagtttgatcgtttgcgggcctccatggtggctaccatt
gaggttccacgggaggagaccaatcgttacggtattctggagggtgagacggtctatgat
ggtatcctgcaaatctcctccatggtggagaagccaaagccggaagatgctccttctaac
cttgccgccattggccgctatatctttaccccccgtatctttgacttccttggcaaacag
cagaccggtgccggtggggagattcaggtcacagatgccatggtggccctgcttgccgag
cagcctattttcggggtcggttttgaagggacccgttttgattgtggcgataaggtgggc
ttccagaaggccaatattgcctttgccctggagcatcctgagattggcggccctttgcgg
gagtatttgcaggggctggagctgtag

DBGET integrated database retrieval system