KEGG   Desulfotalea psychrophila: DP0033Help
Entry
DP0033            CDS       T00192                                 

Definition
asparagine synthetase (WbpS)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
dps  Desulfotalea psychrophila
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dps00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DP0033
Enzymes [BR:dps01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     DP0033
Peptidases [BR:dps01002]
 Cysteine Peptidases
  Family C44
   DP0033
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(33362..35266)
Genome map
AA seq 634 aa AA seqDB search
MCGLAGFFNYQFIADNTILHLQSMGKSISHRGPDASGTWYDADTGIGLVHTRLAIVDLSS
AGHQPMHSQCDRYVIAFNGEIYNHLMLRQKLEQANQAPAWRGHSDTETLLACFVAWGIEQ
TLKVTVGMFALALWDKQEQNLTLARDRAGEKPLYWGWQGDTLLFGSELKALKAHPDFKAK
VSRDALAVYMRHNYISAPQSIYEGIYKLLPGHYVTLNSVSNIDTATPKAYWTMNQAIESG
IAQPFSGTDIEAVDLLEHRLSQSIGGQMLADVPLGAFLSGGVDSSVVVALMQKQAQQSVK
TYAIGFDDPRYNEAQYAAAVARHLGTEHTELYVSAQDALELVPQLPSIYCEPFADSSQLP
TFLVTKMARQHVTVALSGDGGDELFGGYTPYLFTPRYWNLLKCYPQPLRAALAASMSRLP
LPDKFLKLAEVMGASNKESFYRSIMSHWGQPEDVVIGAKEPASVLNSSDLWPETDSFEHW
MMAMEAQMYMPDDILVKVDRAAMANSLETRVPLLDHRVIELAWQLPLSMKIRDGKGKWVL
REVLYRHVPRELIERPKKGFSIPLANWLRGPLRDWAEALLDEKRLRGEGYFYPAPIREAW
QQHVQGKRDNASKLWSVLMFQAWLDEQDANSITL
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggtctggcaggtttttttaattaccaattcattgcagataatactatcttgcat
ttacaatcaatggggaaatcaatttctcatcgcggtcccgatgcctcaggcacttggtac
gatgctgatacaggtattggtctggtgcatacgcggcttgctattgttgatttgtcctcc
gccggtcaccagccaatgcactcgcagtgtgatcgttatgttattgcatttaatggcgag
atatacaaccatttgatgttacgtcaaaagctggaacaggctaatcaggcgccagcctgg
cgtggacattcagatacagagaccttgcttgcctgttttgtagcctggggaatagagcaa
acacttaaggtcacggtggggatgtttgctcttgccctgtgggataagcaggagcaaaat
ttgacccttgcccgcgatcgtgctggtgaaaagcccttatactgggggtggcaaggtgat
acgctgttatttggttctgaacttaaggctctgaaggctcatcctgattttaaggccaag
gtaagtcgtgatgcactggccgtatatatgcgtcataactatatctctgcaccacagagt
atttatgaaggtatttataaactattaccagggcattacgtcactttaaatagtgtatca
aatatagatactgctactccaaaagcttactggacaatgaatcaggcgattgaatctggc
atcgcccagccattcagcggtaccgatattgaagcggttgaccttctagagcatcgcttg
tcacagagtattggtgggcaaatgttggcggatgttcccttgggggcatttttaagtggt
ggggtcgatagcagtgtggttgtggcgcttatgcaaaagcaggcgcagcaatcggttaag
acctatgccatcggttttgatgatccccgttacaatgaggcacaatatgccgctgcggtg
gctcgccatttgggaactgagcataccgagctgtatgtatcggctcaggatgcactggaa
cttgtaccgcagttaccatcgatttactgcgaaccctttgccgacagttctcagttgccg
acatttttggtaactaaaatggccaggcagcatgtaaccgtagcgctcagtggcgatggt
ggagatgagctgtttggcggttataccccctacctgtttactccgcgttactggaacttg
ctgaaatgctaccctcagccactgcgggcagcacttgctgccagtatgagtagactgcca
ttacctgataagtttcttaaactggccgaggtgatgggtgcttcgaataaagagtcattt
tatcggagcatcatgagtcattgggggcagccagaagacgtggtcattggtgctaaagag
cctgcgtctgttttaaatagctcggatctgtggccagaaacggacagcttcgagcactgg
atgatggccatggaagcacagatgtatatgccagatgatattttggttaaagttgaccgt
gcagcaatggctaatagtttggaaacccgcgtgcctttgttggatcacagagtgattgaa
ttggcttggcaattgcccttgagcatgaaaattcgagatggcaaaggcaagtgggtattg
cgtgaagtgttgtatcgtcatgtgcctcgagaattgatagaacgccctaaaaaaggtttt
tccattcctttggcaaattggcttcgcggccctttacgtgactgggccgaagctctgctt
gatgaaaaacgcttgcgaggtgaagggtacttttatccagcgccaatacgtgaagcatgg
cagcaacatgtgcagggcaagcgtgataatgcaagtaagctgtggagtgtgcttatgttt
caagcatggctggatgagcaagatgcgaactcgataacactctga

DBGET integrated database retrieval system