KEGG   Desulfotalea psychrophila: DP0079Help
Entry
DP0079            CDS       T00192                                 

Definition
related arylesterase [precursor]
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
dps  Desulfotalea psychrophila
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:dps01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(87618..88259)
Genome map
AA seq 213 aa AA seqDB search
MNKIYAVLLLFALCACRGEGVVSGKNGGRILAVGDSLTAGYGLEKEDAYPALLQTKLARM
GYAFEVINLGVSGEVSAQTLARASDILAYEPDIVILETGANDGLRGYAPAKIKDNISQLL
QIFADNDVVVVLAGMKVRATRGQAYMQRYNRIYSQLEEDYSPVFFPFFLEGVALDWRYNQ
LDRLHPNQAGYQIIVDNILPFVVKGIERVEVNR
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaatatatgctgtactgctgttattcgccctttgtgcctgccgtggcgagggt
gttgtgtccgggaaaaatggggggcgtattcttgctgtgggtgatagcctgactgctggc
tatggcctggaaaaggaggatgcctacccagccctactccagacaaaacttgcccggatg
ggttatgcctttgaggttataaaccttggcgtaagtggggaggtcagtgctcaaaccctt
gcccgtgcatctgatattttggcctatgagcctgatattgttatcctggagacaggcgct
aacgatggccttaggggctatgcccctgccaaaataaaggataatatttctcagttactg
caaatttttgcagataatgacgttgttgttgtcctggcggggatgaaggttagggcgacc
agggggcaggcctatatgcagagatacaataggatctattctcagctggaagaggattat
agtcctgtcttttttccattttttctagagggtgttgccctcgactggcgttataatcag
ttggataggcttcaccccaaccaggcgggctatcaaataattgttgataatatcttgccc
tttgtggttaaaggcatagaacgggttgaggtgaacaggtag

DBGET integrated database retrieval system