KEGG   Desulfotalea psychrophila: DP0100Help
Entry
DP0100            CDS       T00192                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dps  Desulfotalea psychrophila
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:dps00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DP0100
   01230 Biosynthesis of amino acids
    DP0100
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DP0100
   00051 Fructose and mannose metabolism
    DP0100
   00562 Inositol phosphate metabolism
    DP0100
Enzymes [BR:dps01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     DP0100
Exosome [BR:dps04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   DP0100
  Exosomal proteins of bladder cancer cells
   DP0100
  Exosomal proteins of melanoma cells
   DP0100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(109899..110654)
Genome map
AA seq 251 aa AA seqDB search
MKRKALIAGNWKMHMTVLEGCRLAAEIVASCKDYTDREVLLAPPCTIISEVSHILAGSKI
ILSSHNVCWEEKGAFTGEISPTMLQDAGASCAIVGHSERRQVFFESDEVINKRLKGALAF
GLMGILCIGETLEEREAGNTQAVLERQVRKGLADVPASQMKQVVLAYEPVWAIGTGVTAS
KEQVQETHAALRQLISEIYEKDIAEGLRILYGGSVKATNVDELMSQQDIDGALVGGAALD
SISFARIINFE
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaagagaaaggctttgattgcagggaactggaagatgcatatgacggtgcttgaaggt
tgtcgtctggcagcggaaattgttgcatcctgtaaggattatacggatagagaggtgctt
cttgcaccgccctgcacaataataagcgaagtctcccatatccttgcgggtagtaagatt
atcctctcgtcgcacaatgtctgctgggaagaaaagggtgcctttaccggagagatttct
cccactatgctccaagatgcgggggcaagctgtgcaattgttggccactctgaacgtcgc
caggtattttttgaaagtgatgaggtgattaacaaacgcttaaagggtgctctggccttt
ggtttgatgggcattttatgtattggcgagacccttgaggagcgtgaggcgggcaatacc
caggccgtgcttgagagacaggtgcgtaagggacttgcagatgttcctgcttcccagatg
aaacaggttgttcttgcctatgaacctgtctgggcaattggcaccggagtcacggcaagc
aaggagcaggttcaggaaacacacgctgccctgcggcaattaatttcagaaatatatgaa
aaagatattgcggaaggactgcgtatattgtatggtggctcggttaaagcaaccaatgta
gacgagttgatgtcccaacaggatatcgatggagccttagtaggtggcgcggctttagat
agtatatcttttgctcgcataattaattttgaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system