KEGG   Desulfotalea psychrophila: DP0101Help
Entry
DP0101            CDS       T00192                                 

Definition
(GenBank) probable phosphoglycerate kinase
  KO
K00927  
phosphoglycerate kinase [EC:2.7.2.3]
Organism
dps  Desulfotalea psychrophila
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dps00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DP0101
Enzymes [BR:dps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     DP0101
Exosome [BR:dps04147]
 Exosomal proteins
  Proteins found in most exosomes
   DP0101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(110749..111927)
Genome map
AA seq 392 aa AA seqDB search
MKSLRELELAGKRVLVRVDFNVPMDDKQRITDDIRIRMVLPTLRYVLEQGGRLIICSHMG
RPKGKRVEEYSLAPIARHLAGLLGRDVGIAPDCIGAEVEAQVAALGVGEVLLLQNLRFYG
EETENDAVFAGKLAGLADVYVNDAFAVSHRAHASVVGVAERVAEKCAGFLLQTEIDYFHK
SMNDPIRPLVALVGGAKVSSKIGALENMLGKVDKMIIGGAMANTFLMSQGVDVGASKVED
DLLVTARNFLQAAGERGMKVYLPVDFVVADRFAADAVHKTVPADSVPEGWMALDVGPASS
ILFREALQGAGTIVWNGPMGAFEMDAFAGGTMSLCRDVAASQALSITGGGDSNAAVKKSG
EADNISYMSTGGGAFLQLMEGKTLPGVDALEA
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcgttacgtgaattggaactcgccggtaagcgagtcttggtacgggtggatttt
aatgtgccgatggatgataagcaacgaataaccgacgatattcgtattcgtatggttctt
cccaccctacgctatgtgcttgaacagggtggccgcttaattatctgttctcatatgggt
aggcccaagggcaagcgagttgaggagtatagtcttgctcccatagcccgtcatcttgca
ggtctgctaggcagagatgtcggcattgctccggattgtattggtgctgaggtggaggcg
caggtggcagcccttggcgtaggcgaggtgcttcttttgcaaaaccttcgtttttacggc
gaagaaacggaaaatgatgccgtctttgccggtaagcttgcaggacttgccgatgtctat
gtaaatgatgcctttgccgtatctcatcgagcccatgcctccgtggttggagttgccgag
cgggtagctgaaaaatgtgccggctttctcctgcagacagagatagattattttcataaa
tcgatgaatgaccccattcgtcccctggtggccctggtgggtggagccaaggtctcctct
aagataggtgccctggaaaatatgcttggtaaggtcgataagatgattattggcggtgcc
atggccaataccttcttaatgagtcagggcgtcgatgttggtgcctcaaaggtggaggat
gacctgcttgtcaccgccaggaattttctgcaggcagcaggggagcgggggatgaaggtc
tatcttcccgttgattttgtggttgcagatcgttttgccgccgatgcggtgcacaagact
gtgcccgccgatagtgttccggagggttggatggccctcgatgtcggcccggcaagtagt
attctctttcgagaggccctgcagggtgccggtaccatcgtctggaatgggcccatgggc
gcttttgagatggatgcctttgccggagggaccatgagtctctgtcgtgatgttgccgct
tcgcaggcgctttcgatcactggtggtggggattctaatgccgcagtgaagaaatcaggc
gaggcagataatatctcctatatgtccaccggtggaggggccttcttgcagttgatggag
gggaaaaccctacctggggtggatgccttggaagcataa

DBGET integrated database retrieval system