KEGG   Desulfotalea psychrophila: DP0277Help
Entry
DP0277            CDS       T00192                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
dps  Desulfotalea psychrophila
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dps00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    DP0277
Enzymes [BR:dps01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     DP0277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
300360..301757
Genome map
AA seq 465 aa AA seqDB search
MTKQLDTIIVGAGLSGLTVAHKLRLKDKLHSLLIIDREEQSGGVIRTHRQDGFISEIGPH
GFLDNNPASKLILAETGLDKETVKAPLMDFVRYVYLHDKLNLIEQTPGKIIMAPLISWPA
KFRVLADLWKRPLEGDPSIAKWVEHRFGPALLPFIDAIFTGTYAGDYETLTVGSVWPGVR
ELEKKHGSVIRGLIARWIAKKRTGDKTPMNMPSMTSFAEGMARLPERLSEGLSAEELLLN
TDVTAIARGENGWAVKTGTGEEYRATQLVLALPTNEALRLLAPLNTGMPMQKIPEARIAS
VIMGFKGATLPPGFGFLTPEVEKRFSLGCLFSSNMFPGRAPEGHVVIETLVGGKRHPERL
NLDDETIIERALADIRAILDLPNPPVYTRVLRSKSGIPQLEEGYPELLSWRDALVRTYPG
LHLCGFGWEGIGLNEMMKAGTRVAEAVLDAGGSASAQAEIKGIYF
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaacaactcgataccattattgttggagcaggcctttcaggactcaccgtggcc
cataaacttcgcctcaaagacaaactacacagcctcctgattattgacagggaggagcaa
agcggcggtgtcatacgtacccatcggcaagatggctttatctcagaaattggcccccat
ggtttccttgacaataaccctgccagtaagctcatccttgccgagacaggtcttgataag
gagacggtaaaggcaccgcttatggactttgtccgctatgtctacctccacgacaagctg
aacctgatagagcagacgccagggaaaattatcatggcaccgctgatctcctggcctgcc
aagttccgcgttctggccgatctatggaagcggccgctagagggagaccccagcattgcc
aagtgggtcgaacatcgctttggcccggccctactcccctttatagatgcaatctttacg
ggaacctacgccggagactacgagaccctgaccgttggcagtgtctggcctggggtacgt
gagttggaaaaaaaacatggctccgtgattcgcggacttattgcaagatggattgcaaag
aagagaacaggtgacaaaacgcctatgaacatgccgtccatgaccagttttgccgagggt
atggcccgtctaccggagagattaagtgaagggttgtctgccgaagagctcctgctgaat
accgatgttacagccattgccagaggagaaaatggttgggcggtaaagaccgggacaggc
gaagagtacagggcgacacagcttgtcctggccctgccaaccaatgaagccctgcgctta
cttgcaccccttaatacgggaatgccaatgcaaaagatacccgaggcacgaattgcctcg
gtaatcatgggcttcaagggggcaacgctacctccgggatttggctttctcacccctgaa
gtggaaaaacgtttttctctcggctgcctcttctcttcaaatatgtttccgggccgagcc
ccagaaggccatgtggtgatcgagaccctggttggaggcaagcgccaccctgaaaggctg
aatctggacgatgaaaccataatcgagagggcattagctgatattagagcgatccttgac
ctgccgaaccctcccgtctataccagggtactccgctcaaagtcaggaatcccccaactg
gaagagggctacccggaacttctctcctggcgtgatgccctggtaagaacctatcctgga
ctccatctctgcggttttggttgggaaggtattggactcaatgagatgatgaaggcaggt
accagagtggccgaggctgtactggatgccggaggtagcgcctcggctcaggcagagata
aagggcatttatttttaa

DBGET integrated database retrieval system