KEGG   Desulfotalea psychrophila: DP0284Help
Entry
DP0284            CDS       T00192                                 

Definition
succinyl-CoA synthetase, beta chain
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
dps  Desulfotalea psychrophila
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dps00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DP0284
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DP0284
   00640 Propanoate metabolism
    DP0284
   00660 C5-Branched dibasic acid metabolism
    DP0284
Enzymes [BR:dps01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     DP0284
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
312187..313347
Genome map
AA seq 386 aa AA seqDB search
MKIHEYQAKQLFRKYSIPVPEGLLCTNLQEVKTALKSLQLPIAVKAQIHAGGRGKGGGVK
LGKTATEVVQYADDILGMSLVTAQTGPSGRTVSKILLEEGVSIARELYLSILVDRERACI
TIIACQDGGMNIEEVAASTPERIGKIHINPLIGPRSYHINQAREWLNIAQEQARAFSLFI
HALYKLFLDYDCSMVEINPLIITEDNQLIALDAKVDTDSNALFRQRELQKMHDPAEDDPA
EAEAAKFNLNYIKLSGNVGNMVNGAGLAMATMDIIKRAGAEPANFLDVGGSADAERIENG
FRIILADTNVKAILINIFGGILRCDILAQGVVQAAAKVSLQVPVVIRMEGTNVKEGREIL
AKSGLSLINATDLNDAAEKISTLLTD
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatccatgaataccaagccaagcagctgttccgtaaatactctatccccgtaccc
gaaggactcctctgtacgaacctgcaagaggtcaagacggcccttaagtcccttcaactc
cccatcgcagttaaggcccagatacatgccggaggacggggtaagggaggaggggtcaaa
cttggcaaaacagccacagaggtagtgcagtacgccgatgatatcttgggaatgtctctg
gttacggcccagacggggccctcgggcaggactgtttccaaaatactccttgaagaaggc
gtctccatcgcccgcgaactctatctctccatccttgtcgaccgggaaagggcgtgcatc
accatcattgcctgccaggacggtggaatgaatatcgaagaggttgccgcctcaaccccc
gaacgaattggcaaaatccatatcaacccattaattggtccccgttcctaccatatcaat
caggcaagagaatggctgaatattgcccaggaacaggccagagctttttccctctttatc
cacgccctctataaactctttcttgattacgactgttctatggtggagatcaaccccctt
attatcaccgaggataatcagctcatcgccctcgatgccaaggtcgacaccgactccaac
gccctctttcgccagcgggaactgcagaaaatgcacgatcccgccgaagatgatccagca
gaggcagaggccgccaagttcaatctgaactatatcaagctgagcggcaatgtgggcaat
atggtcaacggtgccggtctggccatggccaccatggatattattaaacgggcgggagcg
gaaccagcaaattttctggatgtgggagggagcgccgacgcggaaaggattgaaaacggt
tttcgcatcatcctggccgacaccaatgtaaaggccattcttatcaatatttttggcgga
atccttcgctgtgacatcctcgcccagggcgtggtgcaggccgccgccaaggtatcactc
caggtacctgtcgttatccgcatggaaggtaccaatgtgaaagagggacgtgaaattctg
gccaagtcaggactctccctgataaatgccacagacctgaacgatgccgccgaaaaaatt
tctaccctacttacagattaa

DBGET integrated database retrieval system