KEGG   Desulfotalea psychrophila: DP0311Help
Entry
DP0311            CDS       T00192                                 

Definition
dihydrofolate reductase, type VII
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
dps  Desulfotalea psychrophila
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dps00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    DP0311
   00670 One carbon pool by folate
    DP0311
Enzymes [BR:dps01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     DP0311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
340800..341273
Genome map
AA seq 157 aa AA seqDB search
MKISLMAAKSENGVIGKGADIPWMVKGEQLLFKAITFNQWLLVGRKTFDSMGVLPNRKYA
VITRSGLLSQNDNVLVFPSIEDALRELAQQTEHIIVAGGGEIFKAMINRADTLHLSTVHQ
NIDGDITFPQVPKDFKLVFEQYFESNINYTYQIWQRP
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgaagatttcactcatggcggcaaagtctgaaaacggagtcattggtaaaggagcggat
atcccctggatggtcaaaggggagcagctcttattcaaggcgataaccttcaatcaatgg
ctactggttgggagaaaaactttcgactccatgggggttctgcccaaccgtaaatacgca
gtcatcaccagatccggcctcctctcgcagaatgacaatgtcctcgtttttccttccata
gaggatgctctccgtgaacttgctcaacagacagagcatattatagttgcaggtggtgga
gaaatattcaaggccatgattaacagagccgacaccctacatctatcaacggttcatcaa
aatatcgacggagatattacctttcctcaagtaccgaaggattttaaattagtatttgag
cagtactttgaatcaaatattaattatacctaccagatatggcagagaccatag

DBGET integrated database retrieval system