KEGG   Desulfotalea psychrophila: DP0532Help
Entry
DP0532            CDS       T00192                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
dps  Desulfotalea psychrophila
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:dps00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:dps00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
581392..581940
Genome map
AA seq 182 aa AA seqDB search
MNTLKNQTLPLRIIMKRDFYQFSATNLQGQKIAMKEYRGKVMLVVNTASKCALSSQLRGL
EILYKKYAPLGFVVLGFPCNQFTPQESRDAQNIAEEYLLNYGASFPLFTKTEVVGKGAHP
LFSYLENRLEGIMGPDIKWNFTKFLIDHRGDPVKRFAPITAPAIIAPDIEILLSAQSTAG
EQ
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaataccctaaaaaatcaaaccctaccgttgagaataattatgaagagagacttctac
caattttcagcaacaaacctgcagggccagaagatagccatgaaggagtatcggggcaag
gtgatgctggtggtaaacaccgccagtaaatgcgccctgagctcgcaactcaggggctta
gagatactttataagaaatacgccccactaggatttgtggttctgggttttccctgcaat
caattcacccctcaggaatccagagacgcgcagaacattgccgaagagtacctcctcaac
tacggtgcctcctttcccctcttcaccaaaacagaggtcgttggcaagggagcccacccc
ctcttctcctatctggaaaatagattagagggcataatgggtcccgacattaaatggaac
ttcacaaaattcctcatcgaccacaggggagatccggtaaagaggtttgcccccatcacc
gccccagctataatcgccccggatatagaaatactcctatctgcgcagagcactgcaggc
gagcaatag

DBGET integrated database retrieval system