KEGG   Desulfotalea psychrophila: DP0790Help
Entry
DP0790            CDS       T00192                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dps  Desulfotalea psychrophila
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dps00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DP0790
   01230 Biosynthesis of amino acids
    DP0790
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DP0790
   00051 Fructose and mannose metabolism
    DP0790
   00562 Inositol phosphate metabolism
    DP0790
Enzymes [BR:dps01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     DP0790
Exosome [BR:dps04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   DP0790
  Exosomal proteins of bladder cancer cells
   DP0790
  Exosomal proteins of melanoma cells
   DP0790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
887565..888260
Genome map
AA seq 231 aa AA seqDB search
MKRYIIANWKCQKREVEALQWLDGFLRAYRPVQGREVILAPSFLCLSSFAKRIADSGLPG
LSLAAQDVSPYPRGSYTGALSADLIGDYARVAIVGHSERRKYFHETNHEVTNKVAELADA
DMTPLVCLDDSNMDGQLAALQDSECAEMILAYCPAYALNSNVAEPLDSVARAVAQIRKYQ
AKYPIVYGGAVRLENAAGYWNLDGLSGIFIGGASLELESFMAILDQCHSPS
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgatatattatagctaattggaagtgtcagaagagggaagtggaggctttgcag
tggctcgatggctttttgcgggcctataggcccgttcagggacgtgaggtgattcttgcg
ccctcttttctttgtctgagctcttttgcgaagaggattgcggattcgggtctgcccggc
ctctctctggccgcccaagatgtatctccctacccccgtggttcctacaccggtgccctc
tccgctgatctgataggggactatgccagggtggctatagttgggcactccgagcgcaga
aaatactttcatgagacaaatcatgaggtaacaaataaggtggcggagcttgccgatgca
gatatgacccctcttgtctgccttgatgatagcaatatggatggacaacttgccgccctg
caggacagtgaatgtgccgagatgattcttgcctactgcccggcctatgccttgaactcc
aatgttgccgagccccttgacagcgtggcgagggccgttgctcagataagaaaatatcag
gcaaagtaccctattgtttatgggggtgctgtccgccttgagaatgcggcaggatactgg
aaccttgatggcctgtcgggcatttttattggtggggccagtttggagctagagagcttt
atggcaattttggatcagtgccattccccctcctaa

DBGET integrated database retrieval system